(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE31

PENCW_13.PE31        Location/Qualifiers
FT   CDS             join(complement(71528..72116),complement(71318..71476),
FT                   complement(70732..71265),complement(70393..70670))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000234827" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128155"
FT                   /orf_name="Pc16g00310"
FT                   /product="Pc16g00310 protein"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity"
FT                   /protein_id="CAP92701.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016168"
FT                   /db_xref="UniParc:UPI0001831E90"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6T8"
FT                   /transl_table=1
FT                   /translation="MAKMTSIVGILMGVLTTATAASIPTGSSVAAAAALRSLGVSPPSG
FT                   NVLIGNAGYTCSLLNRVFSKNETFTVTSPYYNVLIDEAWSENCRLNASCIVTPESAQEV
FT                   SRLLQILSILRTKFAIRSGGHNTNPGFSSIGSDGVLIALEKLDRLSLSADRGTVTVGPG
FT                   NRWESVYKYLQPYNLTALGGREAVVGVGGYILGDSGGLSTFYNTHGLAIDSVTRFQVVL
FT                   PNGTIVDATPTEHADLYKGLKGGLNNFGIVTEYDLTTNPGVDIYYEIKTYTAANTPAVL
FT                   AAYATYLLDADINSNVEIQVNPSYTLVFYGYLGHVSAPTDFDSFSDIPVASTIYPPTNG
FT                   SLTELLLTIGSTGLTSEGVSYSGTFSFKVTGSTFLQDTYSTYLEAAASLPSGAVLSYVP
FT                   QGVIPNLVTQGKSQNGGNLLGLEATPQIWANIFAQFPATLSQSEVAGAVDSLLANLISS
FT                   AKSEDLFLPYIFVNDAGAKQKPLQSFGEKNIKYIDTVAKRYDPKRVMQKLQDQAYFVSE
FT                   EL"
     MAKMTSIVGI LMGVLTTATA ASIPTGSSVA AAAALRSLGV SPPSGNVLIG NAGYTCSLLN        60
     RVFSKNETFT VTSPYYNVLI DEAWSENCRL NASCIVTPES AQEVSRLLQI LSILRTKFAI       120
     RSGGHNTNPG FSSIGSDGVL IALEKLDRLS LSADRGTVTV GPGNRWESVY KYLQPYNLTA       180
     LGGREAVVGV GGYILGDSGG LSTFYNTHGL AIDSVTRFQV VLPNGTIVDA TPTEHADLYK       240
     GLKGGLNNFG IVTEYDLTTN PGVDIYYEIK TYTAANTPAV LAAYATYLLD ADINSNVEIQ       300
     VNPSYTLVFY GYLGHVSAPT DFDSFSDIPV ASTIYPPTNG SLTELLLTIG STGLTSEGVS       360
     YSGTFSFKVT GSTFLQDTYS TYLEAAASLP SGAVLSYVPQ GVIPNLVTQG KSQNGGNLLG       420
     LEATPQIWAN IFAQFPATLS QSEVAGAVDS LLANLISSAK SEDLFLPYIF VNDAGAKQKP       480
     LQSFGEKNIK YIDTVAKRYD PKRVMQKLQD QAYFVSEEL                              519
//

If you have problems or comments...

PBIL Back to PBIL home page