(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE310

PENCW_13.PE310       Location/Qualifiers
FT   CDS             join(698972..699098,699391..699486,699543..699933,
FT                   699988..700115,700162..700258,700305..701064)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076670" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947684"
FT                   /orf_name="Pc16g03100"
FT                   /product="Pc16g03100 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP92980.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0001831CDE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8X2"
FT                   /transl_table=1
FT                   /translation="MDASSTARPRRNTRVLTACDACRLSKTRCDSARPVCAKCVQRDMI
FT                   LSWPIFPKEKSVSTFPMAAYSEKPDRFQTALHSLDPQRLLELREIFMTKIWTKNPIVDP
FT                   DQLDFYIARVLENGVDWSASSCLVLLIFALAAIWGNYPDDETREVSYNEPSFSPPVTYL
FT                   TISVPEHRMKESLTFLSMARKRISTAYLDDTLLGVQCLCLFGIWYQYNIEPIPGWKMFR
FT                   TASMLWQTYRLKHREGKTVRSAQEESLEQRLYWTCLKSEWYSIHHTPQILTQLADIQYL
FT                   SDFPYSLPSFPTRQPSNDSAGWVFSNPSSTDLEAASSYYYLAEIFLRRLLNRARNAVRV
FT                   LSPDIDPPTINTLAETLTQLEGQLQQWVDCLPHTLRFNMPLESAPGPKEGELMKLSRER
FT                   YVEVRELLCRAYLYLCIHVPLDAGMAALYGVKASEALLLAVYRIQTEVPFFRHPGSWGA
FT                   CRVRFNHALCLIAGFRAKLTQRPSAEYVTIPPDWADCVRVVIERLKIWGQEGGGIKELS
FT                   VLLEWLMHGNLELSN"
     MDASSTARPR RNTRVLTACD ACRLSKTRCD SARPVCAKCV QRDMILSWPI FPKEKSVSTF        60
     PMAAYSEKPD RFQTALHSLD PQRLLELREI FMTKIWTKNP IVDPDQLDFY IARVLENGVD       120
     WSASSCLVLL IFALAAIWGN YPDDETREVS YNEPSFSPPV TYLTISVPEH RMKESLTFLS       180
     MARKRISTAY LDDTLLGVQC LCLFGIWYQY NIEPIPGWKM FRTASMLWQT YRLKHREGKT       240
     VRSAQEESLE QRLYWTCLKS EWYSIHHTPQ ILTQLADIQY LSDFPYSLPS FPTRQPSNDS       300
     AGWVFSNPSS TDLEAASSYY YLAEIFLRRL LNRARNAVRV LSPDIDPPTI NTLAETLTQL       360
     EGQLQQWVDC LPHTLRFNMP LESAPGPKEG ELMKLSRERY VEVRELLCRA YLYLCIHVPL       420
     DAGMAALYGV KASEALLLAV YRIQTEVPFF RHPGSWGACR VRFNHALCLI AGFRAKLTQR       480
     PSAEYVTIPP DWADCVRVVI ERLKIWGQEG GGIKELSVLL EWLMHGNLEL SN               532
//

If you have problems or comments...

PBIL Back to PBIL home page