(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE311

PENCW_13.PE311       Location/Qualifiers
FT   CDS             join(701821..702031,702164..702304,702354..702615,
FT                   702667..702936,703001..703308,703359..703589,7
FT                   03640..703764)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178887" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671656"
FT                   /orf_name="Pc16g03110"
FT                   /product="Pc16g03110 protein"
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP92981.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831CDF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8X3"
FT                   /transl_table=1
FT                   /translation="MVIVGKQREENLAEPVLANLLADDRTPWYKKPNLRRLYFILFPAC
FT                   MGIEITSGFDSQIINTVQIVYTWNKCAAYSLGAILSLPFVPYVNQLVGRRWTIMFGSGV
FT                   SLVGALIQGFSNGVGMYIVARIILGFGIPFCIVAGSSLLGELGYPKERPILTSLFNSSY
FT                   FIGQIIAAAVGLGTVTIASDWAWRIPSLLQIAPAMVQIATVMFLPESPRYLVSKDRYDD
FT                   AFDILTKYHAEGDRSSTIVKAELAQIERTIKLELEESKQSWWDMFRTAGMRRRLFISAF
FT                   LGLFTQWSGNTLISYYLSDLLNMVGITDGVIKSKINIGIACWGLICGTALALTAPRFKR
FT                   RPMYLTCASALLCVYIAWTISMERFLATKAQSAAIATIFFIFAYSPAYNLGYNALTYTY
FT                   LVELFPYMGRSRGLSWFQFYGRGANFFATYVNPIGLARIAWKWLLVYCCWLLFELVFIY
FT                   FFFPETAGRTLEELSFLFEDKEKANEVAAAVHKQLDEDDEKKTVTAHVEVQDTKNAV"
     MVIVGKQREE NLAEPVLANL LADDRTPWYK KPNLRRLYFI LFPACMGIEI TSGFDSQIIN        60
     TVQIVYTWNK CAAYSLGAIL SLPFVPYVNQ LVGRRWTIMF GSGVSLVGAL IQGFSNGVGM       120
     YIVARIILGF GIPFCIVAGS SLLGELGYPK ERPILTSLFN SSYFIGQIIA AAVGLGTVTI       180
     ASDWAWRIPS LLQIAPAMVQ IATVMFLPES PRYLVSKDRY DDAFDILTKY HAEGDRSSTI       240
     VKAELAQIER TIKLELEESK QSWWDMFRTA GMRRRLFISA FLGLFTQWSG NTLISYYLSD       300
     LLNMVGITDG VIKSKINIGI ACWGLICGTA LALTAPRFKR RPMYLTCASA LLCVYIAWTI       360
     SMERFLATKA QSAAIATIFF IFAYSPAYNL GYNALTYTYL VELFPYMGRS RGLSWFQFYG       420
     RGANFFATYV NPIGLARIAW KWLLVYCCWL LFELVFIYFF FPETAGRTLE ELSFLFEDKE       480
     KANEVAAAVH KQLDEDDEKK TVTAHVEVQD TKNAV                                  515
//

If you have problems or comments...

PBIL Back to PBIL home page