(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE312

PENCW_13.PE312       Location/Qualifiers
FT   CDS             complement(704441..705280)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217620" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947685"
FT                   /orf_name="Pc16g03120"
FT                   /product="Pc16g03120 protein"
FT                   /protein_id="CAP92982.1"
FT                   /db_xref="UniParc:UPI0001831DBA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8X4"
FT                   /transl_table=1
FT                   /translation="MPVATLHLLTLAKSTDAQSFLQQLRQSPSTRVIVASRPRHVVIHP
FT                   NILDNDPLASNPWDLLVLLQITQPNAQDPIPSALRGLITNEYIITTGVPSKLLSDYQAR
FT                   DSRLKNDASSIPLTGSLDKVVRGGSKEASQNLEVSPQLLRFMDELWKTHKGPVTMLNLL
FT                   HFHHPDGKKNYYQYGQAFIPVAGKRGGSAKLVGNVVPPAPEKRDSRGSRNRSQQDWWNE
FT                   ISIVHYPSIRHFCDMLAGEDYQAINERYRLSVSALDALLPFISIEFVEWCNDYLGTS"
     MPVATLHLLT LAKSTDAQSF LQQLRQSPST RVIVASRPRH VVIHPNILDN DPLASNPWDL        60
     LVLLQITQPN AQDPIPSALR GLITNEYIIT TGVPSKLLSD YQARDSRLKN DASSIPLTGS       120
     LDKVVRGGSK EASQNLEVSP QLLRFMDELW KTHKGPVTML NLLHFHHPDG KKNYYQYGQA       180
     FIPVAGKRGG SAKLVGNVVP PAPEKRDSRG SRNRSQQDWW NEISIVHYPS IRHFCDMLAG       240
     EDYQAINERY RLSVSALDAL LPFISIEFVE WCNDYLGTS                              279
//

If you have problems or comments...

PBIL Back to PBIL home page