(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE313

PENCW_13.PE313       Location/Qualifiers
FT   CDS             complement(705975..706925)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000201258" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947686"
FT                   /orf_name="Pc16g03130"
FT                   /product="Pc16g03130 protein"
FT                   /protein_id="CAP92983.1"
FT                   /db_xref="UniParc:UPI0001831DBB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8X5"
FT                   /transl_table=1
FT                   /translation="MAGESGPVEVSRPIAMVIAGLFALACWNVLQILVSIINTFKRRRG
FT                   LYFWSMVIATLGILVHALSTFLRYFALAPNFPMCVLICISWYSMVTGQSVVLYSRLHLV
FT                   TNYDSYSRWVLGMIIFNFCVLHVPTTILFLGINLDVKSFIRPFNIYERVQLAGFAAQET
FT                   IISGLYIWETMTSLRPVLAMKGRRGQKVVINLLVVNTLAVLLDAALLATEYTNHFDVQT
FT                   TLKPVVYSIKLMLEFTVLNSLLLVIRTNPSAIEEVEQLHDDLHIDTGCSGKHFNNTAVF
FT                   IGDPAKSDQGDQGVQISPVRSDPSWISFDHQVKPA"
     MAGESGPVEV SRPIAMVIAG LFALACWNVL QILVSIINTF KRRRGLYFWS MVIATLGILV        60
     HALSTFLRYF ALAPNFPMCV LICISWYSMV TGQSVVLYSR LHLVTNYDSY SRWVLGMIIF       120
     NFCVLHVPTT ILFLGINLDV KSFIRPFNIY ERVQLAGFAA QETIISGLYI WETMTSLRPV       180
     LAMKGRRGQK VVINLLVVNT LAVLLDAALL ATEYTNHFDV QTTLKPVVYS IKLMLEFTVL       240
     NSLLLVIRTN PSAIEEVEQL HDDLHIDTGC SGKHFNNTAV FIGDPAKSDQ GDQGVQISPV       300
     RSDPSWISFD HQVKPA                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page