(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE316

PENCW_13.PE316       Location/Qualifiers
FT   CDS             join(713967..714030,714084..714205,714279..714412,
FT                   714477..714599,714695..715309,715364..715450,7
FT                   15510..715579)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000185898" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947688"
FT                   /orf_name="Pc16g03160"
FT                   /product="Pc16g03160 protein"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transaminase activity"
FT                   /biological_process="biosynthetic process"
FT                   /biological_process="cellular amino acid metabolic process "
FT                   /protein_id="CAP92986.1"
FT                   /db_xref="GO:0006520"
FT                   /db_xref="GO:0008483"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="InterPro:IPR000796"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI0001831DBE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8X8"
FT                   /transl_table=1
FT                   /translation="MGSIAATPFQSPFQDVPAGRTDGLAALVGQFREDTDPNRTDLLVG
FT                   VYKTEEGKAYVLPSVKEAKNRIFNDPDWHHEYRPSALGSQIYRDLSANLLFGRDHRLLR
FT                   EKSFNADARRKWRLPCGRSYVEKPLCAVEGEWEPRDFPSDRLLVLLPYFSSKTNRFDFE
FT                   SFSEAIKSLPAQSVILLQSGAQNPTGCDPTLDQWRELASIFSERGHLAFFDAAYPGFAS
FT                   GDIDTDLQAVRLFAEQEIPVVFVSTYGKSFGLYSERVGILSILVPNEEVGKNIETQLAL
FT                   LARAESGAPPDFGSRIIETVLSDEVLERQWRQEVRDMANQLKHRRDALREGLEKLGTPG
FT                   DWRHITDQNGMFSYVGLSVEQVTLLRNKYHVYLQDSGRISIAGLNNFNIDYTARSISAV
FT                   IKATA"
     MGSIAATPFQ SPFQDVPAGR TDGLAALVGQ FREDTDPNRT DLLVGVYKTE EGKAYVLPSV        60
     KEAKNRIFND PDWHHEYRPS ALGSQIYRDL SANLLFGRDH RLLREKSFNA DARRKWRLPC       120
     GRSYVEKPLC AVEGEWEPRD FPSDRLLVLL PYFSSKTNRF DFESFSEAIK SLPAQSVILL       180
     QSGAQNPTGC DPTLDQWREL ASIFSERGHL AFFDAAYPGF ASGDIDTDLQ AVRLFAEQEI       240
     PVVFVSTYGK SFGLYSERVG ILSILVPNEE VGKNIETQLA LLARAESGAP PDFGSRIIET       300
     VLSDEVLERQ WRQEVRDMAN QLKHRRDALR EGLEKLGTPG DWRHITDQNG MFSYVGLSVE       360
     QVTLLRNKYH VYLQDSGRIS IAGLNNFNID YTARSISAVI KATA                        404
//

If you have problems or comments...

PBIL Back to PBIL home page