(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE317

PENCW_13.PE317       Location/Qualifiers
FT   CDS             complement(716612..717457)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947689"
FT                   /orf_name="Pc16g03170"
FT                   /product="Putative uncharacterized protein Pc16g03170 "
FT                   /protein_id="CAP92987.1"
FT                   /db_xref="UniParc:UPI0001831DBF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8X9"
FT                   /transl_table=1
FT                   /translation="MAFSGFAEPTLLDLVPTLVGESNFTEWTTALKWTLDSRDIRYYQL
FT                   LTGVWSEPNAVDSAQPTSTEVEARAQWDTASRYLLPLLNATVHQTAKFYILDANNARTA
FT                   YANLHRAFAARSYAAGFANFLKFINTTYTSNQPQAFVNEWRAALGELQECNSTKLTPLL
FT                   IFYHFLHAVSANPAAHPWLDGFLNSKVSTDTTIEATFADFVVSEDRRLNALNQAHSFSL
FT                   NKGKHLPFFCEFHQRQAGHSSENCFRNPANHAPVNKPASAPAPATVPAQGPATQDPPAK
FT                   "
     MAFSGFAEPT LLDLVPTLVG ESNFTEWTTA LKWTLDSRDI RYYQLLTGVW SEPNAVDSAQ        60
     PTSTEVEARA QWDTASRYLL PLLNATVHQT AKFYILDANN ARTAYANLHR AFAARSYAAG       120
     FANFLKFINT TYTSNQPQAF VNEWRAALGE LQECNSTKLT PLLIFYHFLH AVSANPAAHP       180
     WLDGFLNSKV STDTTIEATF ADFVVSEDRR LNALNQAHSF SLNKGKHLPF FCEFHQRQAG       240
     HSSENCFRNP ANHAPVNKPA SAPAPATVPA QGPATQDPPA K                           281
//

If you have problems or comments...

PBIL Back to PBIL home page