(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE318

PENCW_13.PE318       Location/Qualifiers
FT   CDS             join(complement(719171..719221),complement(718937..719077),
FT                   complement(718740..718859),complement(718498..718667),
FT                   complement(718197..718256),complement(718056..718147),
FT                   complement(717866..717966))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824335"
FT                   /orf_name="Pc16g03180"
FT                   /product="Putative uncharacterized protein Pc16g03180 "
FT                   /protein_id="CAP92988.1"
FT                   /db_xref="UniParc:UPI0001831DC0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Y0"
FT                   /transl_table=1
FT                   /translation="MAIYSAGYLTTSYVRILEDRHVKIETMPVLEQKTGPLYPEILAIM
FT                   RRYNLNVASAFQCGKMTMATPLANTRNLRMHPPPYPGGDSRPDPFWASQPGHHECCCSV
FT                   QRGQCAGGDKLGNLRVKNDTVICETTTAFALGDVVAPRSLVLMPRARRFFTHNRDKKPA
FT                   DIRSAKSISGSESGLLHKLPRSKHDMRVQPRQENIVLHFMSNRYGRVPGPQMPYAMFQI
FT                   WAIPYPYALYGDIDCRGRQSSY"
     MAIYSAGYLT TSYVRILEDR HVKIETMPVL EQKTGPLYPE ILAIMRRYNL NVASAFQCGK        60
     MTMATPLANT RNLRMHPPPY PGGDSRPDPF WASQPGHHEC CCSVQRGQCA GGDKLGNLRV       120
     KNDTVICETT TAFALGDVVA PRSLVLMPRA RRFFTHNRDK KPADIRSAKS ISGSESGLLH       180
     KLPRSKHDMR VQPRQENIVL HFMSNRYGRV PGPQMPYAMF QIWAIPYPYA LYGDIDCRGR       240
     QSSY                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page