(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE32

PENCW_13.PE32        Location/Qualifiers
FT   CDS             join(72462..73015,73073..73295)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671088"
FT                   /orf_name="Pc16g00320"
FT                   /product="Pc16g00320 protein"
FT                   /protein_id="CAP92702.1"
FT                   /db_xref="UniParc:UPI0001831E91"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6U3"
FT                   /transl_table=1
FT                   /translation="MGFFALEEWAAANRDYENTRAPYWHVKSVPDGFTAISGILWSISY
FT                   TLMAKKAFKDRSYAMPLHCLCLNITWEAVYGFVYGPGLLNQVVFAQWMIVDVVLFYAIL
FT                   RSAPYVWKQSPLVAQHLAGIIVVGCVICLWLHLAIAATFIPSIGRQVVFMTAWPMQVLI
FT                   NFSSIAQLLSRGNTLGHSWGIWWTRMLGTIAAACCFFWRIHYWPERFGYAWTPYGQFLL
FT                   LGSIGSDMVYAVVYIYVQRMEKQLDTLVSTKAQKAR"
     MGFFALEEWA AANRDYENTR APYWHVKSVP DGFTAISGIL WSISYTLMAK KAFKDRSYAM        60
     PLHCLCLNIT WEAVYGFVYG PGLLNQVVFA QWMIVDVVLF YAILRSAPYV WKQSPLVAQH       120
     LAGIIVVGCV ICLWLHLAIA ATFIPSIGRQ VVFMTAWPMQ VLINFSSIAQ LLSRGNTLGH       180
     SWGIWWTRML GTIAAACCFF WRIHYWPERF GYAWTPYGQF LLLGSIGSDM VYAVVYIYVQ       240
     RMEKQLDTLV STKAQKAR                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page