(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE321

PENCW_13.PE321       Location/Qualifiers
FT   CDS             join(722187..722881,722934..723021,723090..723917)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824336"
FT                   /orf_name="Pc16g03210"
FT                   /product="Pc16g03210 protein"
FT                   /protein_id="CAP92991.1"
FT                   /db_xref="UniParc:UPI0001831DC1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Y1"
FT                   /transl_table=1
FT                   /translation="MSSTTPETMTQRSPVSTKVEHEDFLMNKIIEQFRQLTFDPDFQKA
FT                   SATYSQVKDQQDQIQIRDEKLDKLQKHIKAQEENELVALSRFSAVNQALTTQKEKAEKE
FT                   NASLRKAVIEREKSLTEISRRIQELQGQIQTQLSERSQDERRMTSIIAQHKLDIGSLQR
FT                   RLTERDTSVDEMKATTANLESLLAKEQTKSVCLETEKKSLDENMQMARSRLEKFDAFIL
FT                   ESHQIDEQSIIDRFEGIWDYAINEIWTVLRQNLSDENLKNDRAWKKFRLDTAAAIRDGA
FT                   IQGQPAPLSASNSDAAKGMRLAVMLGILSREIDNEIFQPSYFPSETGNFRMSLNKLAKS
FT                   DNEKERFYRSVLLSIDRDGQETELQSRAKSVVQNVSHYLYELLSTAQYGELKERIKNVV
FT                   DRAIEVWRPIQNSTKRYETEFDPVDWAHDEDSLFQFPVGGEDTIGAEHQDDHLCVIFPG
FT                   LFSLERDDALILTSVVPLMSSQRLYVAANQELREEVRGQSSPTTKQPSRKRQNSVAKAQ
FT                   SQSNGIGFLGGHSSGGSSN"
     MSSTTPETMT QRSPVSTKVE HEDFLMNKII EQFRQLTFDP DFQKASATYS QVKDQQDQIQ        60
     IRDEKLDKLQ KHIKAQEENE LVALSRFSAV NQALTTQKEK AEKENASLRK AVIEREKSLT       120
     EISRRIQELQ GQIQTQLSER SQDERRMTSI IAQHKLDIGS LQRRLTERDT SVDEMKATTA       180
     NLESLLAKEQ TKSVCLETEK KSLDENMQMA RSRLEKFDAF ILESHQIDEQ SIIDRFEGIW       240
     DYAINEIWTV LRQNLSDENL KNDRAWKKFR LDTAAAIRDG AIQGQPAPLS ASNSDAAKGM       300
     RLAVMLGILS REIDNEIFQP SYFPSETGNF RMSLNKLAKS DNEKERFYRS VLLSIDRDGQ       360
     ETELQSRAKS VVQNVSHYLY ELLSTAQYGE LKERIKNVVD RAIEVWRPIQ NSTKRYETEF       420
     DPVDWAHDED SLFQFPVGGE DTIGAEHQDD HLCVIFPGLF SLERDDALIL TSVVPLMSSQ       480
     RLYVAANQEL REEVRGQSSP TTKQPSRKRQ NSVAKAQSQS NGIGFLGGHS SGGSSN           536
//

If you have problems or comments...

PBIL Back to PBIL home page