(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE322

PENCW_13.PE322       Location/Qualifiers
FT   CDS             join(complement(730307..730464),complement(730145..730247),
FT                   complement(729900..730085),complement(729748..729848),
FT                   complement(729553..729692),complement(729424..729485),
FT                   complement(729247..729383),complement(729075..729192),
FT                   complement(728871..729024),complement(728545..728809),
FT                   complement(728439..728493),complement(728160..728364),
FT                   complement(727869..728104),complement(727456..727818))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977568"
FT                   /orf_name="Pc16g03220"
FT                   /product="Pc16g03220 protein"
FT                   /protein_id="CAP92992.1"
FT                   /db_xref="InterPro:IPR020864"
FT                   /db_xref="UniParc:UPI0001831DC2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Y2"
FT                   /transl_table=1
FT                   /translation="MGESKENLFNVWTYDKAEKTKITDRIVIGSIKDNATLADIREALI
FT                   KSKLDSKKARFPFCSKDGARIGDDAKWQLYKELTAGAPTKQSSKNGDDEQPTEGASKEG
FT                   DTPTLSITAHDVYFELSEEETNRKYGELGANVQKLLDTPLDLELGKDKVNLLRANIADF
FT                   ELEGYNHKQWKSKASSTDAISAGSLSDADWDIVSRTTHFLNGHRMVFLENAGGRRKFQR
FT                   IDKAPYPARSLDEMGMAGPNVTLPTDNPKTKILYKYPLYTVTDDSYVNVFETANALSNS
FT                   LASSNFSSMDVEASIGGGLFGYSAAAKGGFSKSDSDALATSEQSKQRTMNITYNFPRVV
FT                   LHLDNDTLELTKGCKEALDHIIKLREDPKVASWQERRAIIKFYQKFGHFFATNVELGGK
FT                   LFSKEEFSSSDVGKTAEKSNAMKISAALSFSSPVVQASASYSQESQSASGSASQTSNMS
FT                   KALSWEAVGGDTTLCNNPPEWSSTVKPFKNWRVINQKDVMAIAEFIGTFPDYGKIPEMF
FT                   KMISNESSQKTPCRFLLQADPGDDGKIKGIQYYGLRKDNGQTRNEGMFDTLRDWCLKDE
FT                   EVVNAFGVDGINKSTNNAKYKFKQDTYTDGWHEWVGIDPQSSRTVGGGCIFELDVETQL
FT                   GRPPRLTYNTPYKLFNKATKSYLAADVGWDAKIAGRTMGLLFYSRSDARIGTFVFQKAN
FT                   QPSATGTIDEGANVSLHLCDENNVPIGQVKRNINDQSTLGVERSDCELKFLFVTNNAYM
FT                   RYDESDN"
     MGESKENLFN VWTYDKAEKT KITDRIVIGS IKDNATLADI REALIKSKLD SKKARFPFCS        60
     KDGARIGDDA KWQLYKELTA GAPTKQSSKN GDDEQPTEGA SKEGDTPTLS ITAHDVYFEL       120
     SEEETNRKYG ELGANVQKLL DTPLDLELGK DKVNLLRANI ADFELEGYNH KQWKSKASST       180
     DAISAGSLSD ADWDIVSRTT HFLNGHRMVF LENAGGRRKF QRIDKAPYPA RSLDEMGMAG       240
     PNVTLPTDNP KTKILYKYPL YTVTDDSYVN VFETANALSN SLASSNFSSM DVEASIGGGL       300
     FGYSAAAKGG FSKSDSDALA TSEQSKQRTM NITYNFPRVV LHLDNDTLEL TKGCKEALDH       360
     IIKLREDPKV ASWQERRAII KFYQKFGHFF ATNVELGGKL FSKEEFSSSD VGKTAEKSNA       420
     MKISAALSFS SPVVQASASY SQESQSASGS ASQTSNMSKA LSWEAVGGDT TLCNNPPEWS       480
     STVKPFKNWR VINQKDVMAI AEFIGTFPDY GKIPEMFKMI SNESSQKTPC RFLLQADPGD       540
     DGKIKGIQYY GLRKDNGQTR NEGMFDTLRD WCLKDEEVVN AFGVDGINKS TNNAKYKFKQ       600
     DTYTDGWHEW VGIDPQSSRT VGGGCIFELD VETQLGRPPR LTYNTPYKLF NKATKSYLAA       660
     DVGWDAKIAG RTMGLLFYSR SDARIGTFVF QKANQPSATG TIDEGANVSL HLCDENNVPI       720
     GQVKRNINDQ STLGVERSDC ELKFLFVTNN AYMRYDESDN                             760
//

If you have problems or comments...

PBIL Back to PBIL home page