(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE323

PENCW_13.PE323       Location/Qualifiers
FT   CDS             complement(732278..733354)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076671" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947690"
FT                   /orf_name="Pc16g03230"
FT                   /product="Pc16g03230 protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP92993.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI0001831DC3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Y3"
FT                   /transl_table=1
FT                   /translation="MAPLSEIIKLEPEREPWCAGYAPSQGRRCHARTNARGRSSAMMLL
FT                   NDGSKDLRVGRNIDTLLEDLAPHVLCIRFHKSQASDLVRRWKRQVRTYLDSQVVSTPYT
FT                   RPVRTSSQRIFEPAEANMEERIAILHQELRDAEEEVRRLKLAQSGLPVNTNPRHYEGRN
FT                   MSAVVNSSSTGSTSSRNPPVNCLNETLRGDLTESSTNRSAIAVPRPVQAQASRQTSAAS
FT                   ISSTRSLNTATMPRIFSSPGNTASQGETFQPNRREIEGECGICLNDLDGPQDEDLDAGE
FT                   GSENSGGYDHGDNDQDKDDEEDNYDGYDDDGDDDEPLNELVWCKARCGVNFHKRCIDQW
FT                   LETDQAPTCPACRSNWKH"
     MAPLSEIIKL EPEREPWCAG YAPSQGRRCH ARTNARGRSS AMMLLNDGSK DLRVGRNIDT        60
     LLEDLAPHVL CIRFHKSQAS DLVRRWKRQV RTYLDSQVVS TPYTRPVRTS SQRIFEPAEA       120
     NMEERIAILH QELRDAEEEV RRLKLAQSGL PVNTNPRHYE GRNMSAVVNS SSTGSTSSRN       180
     PPVNCLNETL RGDLTESSTN RSAIAVPRPV QAQASRQTSA ASISSTRSLN TATMPRIFSS       240
     PGNTASQGET FQPNRREIEG ECGICLNDLD GPQDEDLDAG EGSENSGGYD HGDNDQDKDD       300
     EEDNYDGYDD DGDDDEPLNE LVWCKARCGV NFHKRCIDQW LETDQAPTCP ACRSNWKH         358
//

If you have problems or comments...

PBIL Back to PBIL home page