(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE324

PENCW_13.PE324       Location/Qualifiers
FT   CDS             join(737147..737190,737258..737410,737470..737545)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000166313" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947691"
FT                   /orf_name="Pc16g03240"
FT                   /product="Pc16g03240 protein"
FT                   /protein_id="CAP92994.1"
FT                   /db_xref="InterPro:IPR018824"
FT                   /db_xref="UniParc:UPI0001831DC4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Y4"
FT                   /transl_table=1
FT                   /translation="MSTEDRLNQMRGYKATLSNPNVSEEAKQNAQAMLNELGGDQPREE
FT                   LYQARGDQNKDPMRVSAGLKAAQHNPGVTEGGKQEAAEKMEGPGD"
     MSTEDRLNQM RGYKATLSNP NVSEEAKQNA QAMLNELGGD QPREELYQAR GDQNKDPMRV        60
     SAGLKAAQHN PGVTEGGKQE AAEKMEGPGD                                         90
//

If you have problems or comments...

PBIL Back to PBIL home page