(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE325

PENCW_13.PE325       Location/Qualifiers
FT   CDS             join(739329..739937,739986..740216)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000288287" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824337"
FT                   /orf_name="Pc16g03250"
FT                   /product="Pc16g03250 protein"
FT                   /function="transporter activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP92995.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="UniParc:UPI0001831DC5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H8Y5"
FT                   /transl_table=1
FT                   /translation="MIHRRVLKPYAAEFLGTALLIVIGDGVVAQCLLSDYNYGTWLSIN
FT                   VAWAAAVSLSSYLSDPSPTINPAVTLCLALVRPYEGQWKQVPGKLAAQFLGGFVGAAIV
FT                   YINYRSAIKAWDPEYTIPGGSILSPVGHHSAGIFSTYPGAFFESNWEAVFSEMLGSAVL
FT                   MFGCLSISDPRNAHRLPAPQIALFLLLLMIGAALGWQTGYAINPARDFGPRLFSAIIYG
FT                   REVFTAANCYFVVPLFAPIVGCVLGAATYDGMLFEGEGSRIADALDEAENHGSLRLQ"
     MIHRRVLKPY AAEFLGTALL IVIGDGVVAQ CLLSDYNYGT WLSINVAWAA AVSLSSYLSD        60
     PSPTINPAVT LCLALVRPYE GQWKQVPGKL AAQFLGGFVG AAIVYINYRS AIKAWDPEYT       120
     IPGGSILSPV GHHSAGIFST YPGAFFESNW EAVFSEMLGS AVLMFGCLSI SDPRNAHRLP       180
     APQIALFLLL LMIGAALGWQ TGYAINPARD FGPRLFSAII YGREVFTAAN CYFVVPLFAP       240
     IVGCVLGAAT YDGMLFEGEG SRIADALDEA ENHGSLRLQ                              279
//

If you have problems or comments...

PBIL Back to PBIL home page