(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE329

PENCW_13.PE329       Location/Qualifiers
FT   CDS             join(745934..745960,746072..746110,746168..746242,
FT                   746327..746592,746770..746777,746876..746895)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208396" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947693"
FT                   /orf_name="Pc16g03290"
FT                   /product="Pc16g03290 protein"
FT                   /EC_number="3.6.4.2"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAP92999.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR005334"
FT                   /db_xref="UniParc:UPI0001831DC9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7N4"
FT                   /transl_table=1
FT                   /translation="MSAEGASASPIPIEDLTKITDEACENALATTKGYDHENVGDWNSK
FT                   IINSILKALITATAPDASKPPSYRFTVNSTIVQQGVIDPSVAADGALSNAGKRGMHSAS
FT                   GAFWDVNRDGMWTYKYTGAEDRGMDIVVCVTCPMDMSRNM"
     MSAEGASASP IPIEDLTKIT DEACENALAT TKGYDHENVG DWNSKIINSI LKALITATAP        60
     DASKPPSYRF TVNSTIVQQG VIDPSVAADG ALSNAGKRGM HSASGAFWDV NRDGMWTYKY       120
     TGAEDRGMDI VVCVTCPMDM SRNM                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page