(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE33

PENCW_13.PE33        Location/Qualifiers
FT   CDS             join(complement(73846..74340),complement(73504..73791))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000185387" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945516"
FT                   /orf_name="Pc16g00330"
FT                   /product="Pc16g00330 protein"
FT                   /protein_id="CAP92703.1"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniParc:UPI0001831E92"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6U4"
FT                   /transl_table=1
FT                   /translation="MAPCKPRTFTAGQVPLTKFDGAISVRNLPRPPDRLFLFHGIMRPS
FT                   RGIYAKLIATGQKPPTHFHPSQWEFFRVLRGNLTIDFNGRAIHRTASDGELAVPPFTHH
FT                   VIYGTPGTEMNEVEFVVSASDPAAEQQGATVMDQPFFENWYGYQEDVFQRGEKLDFIQV
FT                   LSMFDAGGTYLSPPWWVPFRSWVGLFLGIVVGRWIGGLLGYAPFYPEWTTDWEAACETM
FT                   QQSWFQRRFADPQAQERARERFRGQLEQEASAKGGKSV"
     MAPCKPRTFT AGQVPLTKFD GAISVRNLPR PPDRLFLFHG IMRPSRGIYA KLIATGQKPP        60
     THFHPSQWEF FRVLRGNLTI DFNGRAIHRT ASDGELAVPP FTHHVIYGTP GTEMNEVEFV       120
     VSASDPAAEQ QGATVMDQPF FENWYGYQED VFQRGEKLDF IQVLSMFDAG GTYLSPPWWV       180
     PFRSWVGLFL GIVVGRWIGG LLGYAPFYPE WTTDWEAACE TMQQSWFQRR FADPQAQERA       240
     RERFRGQLEQ EASAKGGKSV                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page