(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE331

PENCW_13.PE331       Location/Qualifiers
FT   CDS             join(749457..750071,750129..750560)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671657"
FT                   /orf_name="Pc16g03310"
FT                   /product="Pc16g03310 protein"
FT                   /protein_id="CAP93001.1"
FT                   /db_xref="UniParc:UPI0001831DCB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7N6"
FT                   /transl_table=1
FT                   /translation="MGSIDPNHAAFGLDQPAFDEQAFLNGLANLDADGPFNASNGFNYE
FT                   GNPDLMKSFDEYFASIPLDNLDMPGLDQPMSATPANCSAQPVSNNLPVHAPHMQMAYDP
FT                   SIGVAYTPEDTDADKVRKWENLIAQANLANAGVPPSAPEPIAGETVEQVTQVPDSPNSL
FT                   FDSPRSPSVEIIRTPSPTPPTPSPPQPPAATVATFSAAPNATANAARAVQLPRALTSQK
FT                   GYVQHVSPFAPVATISPPASSAANSRELENARLRIQSLAKERSFYQRNLRKATTIDPKT
FT                   GKTSLQKLHAENLSLRRTNANQAQKLQDMKDEINQEKSKFAALGAQYNEVAKRLHKAMV
FT                   ELRELKGQ"
     MGSIDPNHAA FGLDQPAFDE QAFLNGLANL DADGPFNASN GFNYEGNPDL MKSFDEYFAS        60
     IPLDNLDMPG LDQPMSATPA NCSAQPVSNN LPVHAPHMQM AYDPSIGVAY TPEDTDADKV       120
     RKWENLIAQA NLANAGVPPS APEPIAGETV EQVTQVPDSP NSLFDSPRSP SVEIIRTPSP       180
     TPPTPSPPQP PAATVATFSA APNATANAAR AVQLPRALTS QKGYVQHVSP FAPVATISPP       240
     ASSAANSREL ENARLRIQSL AKERSFYQRN LRKATTIDPK TGKTSLQKLH AENLSLRRTN       300
     ANQAQKLQDM KDEINQEKSK FAALGAQYNE VAKRLHKAMV ELRELKGQ                    348
//

If you have problems or comments...

PBIL Back to PBIL home page