(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE332

PENCW_13.PE332       Location/Qualifiers
FT   CDS             join(complement(751320..751460),complement(751221..751284),
FT                   complement(751128..751143),complement(750998..751084),
FT                   complement(750631..750955))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977570"
FT                   /orf_name="Pc16g03320"
FT                   /product="Putative uncharacterized protein Pc16g03320 "
FT                   /protein_id="CAP93002.1"
FT                   /db_xref="UniParc:UPI0001831DCC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7N7"
FT                   /transl_table=1
FT                   /translation="MRSVVNAQYLPSQFVEPVSGSLIPTSRLVGIIVVIKGWEYQERTG
FT                   DQGLRRVDGREGYLGLMREVDERGESAVWKRVLQSRRSSSRKKSGTMCAGSQHIRRETV
FT                   IRTHHEYRYEGTVFRIVRWLNPSRAFTALSSPQLVQVDYWCLQPGGLGITSFTSFQGWN
FT                   NPGERTSPKSHTSKVGCTGTYKQVSGYGLPSGSDYACIRNIGTENEC"
     MRSVVNAQYL PSQFVEPVSG SLIPTSRLVG IIVVIKGWEY QERTGDQGLR RVDGREGYLG        60
     LMREVDERGE SAVWKRVLQS RRSSSRKKSG TMCAGSQHIR RETVIRTHHE YRYEGTVFRI       120
     VRWLNPSRAF TALSSPQLVQ VDYWCLQPGG LGITSFTSFQ GWNNPGERTS PKSHTSKVGC       180
     TGTYKQVSGY GLPSGSDYAC IRNIGTENEC                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page