(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE333

PENCW_13.PE333       Location/Qualifiers
FT   CDS             join(754317..754499,754567..755292)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217034" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671658"
FT                   /orf_name="Pc16g03330"
FT                   /product="Pc16g03330 protein"
FT                   /protein_id="CAP93003.1"
FT                   /db_xref="UniParc:UPI0001831E9D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7N8"
FT                   /transl_table=1
FT                   /translation="MPLRIIEGESPEPVPWGSLPLDIYLLSEWETPHPSQPTESPSARR
FT                   RRLIRQFLALGLEGRRPYQARTETPPTPTKAQIAEILLPVRPEALRPYAAYTTCLEEGL
FT                   WLRLCYKKEEAHESIWSHNEDVAYVGPDGVVLDDEEIFGGLDLAAALEIFPERVTNGGS
FT                   SGHIKLREETLREILGDLEDDTGSGEEDYSDDIKEKVAEFRASRAKNPLLKYGLYHAAC
FT                   VVTHAFVEDEVALDGGGLLHVFWDDCGNVVRQWRVEDDGAEDNFDGAWAEGAWKENFIN
FT                   GIGELGPAYHEGGMRGPPYNV"
     MPLRIIEGES PEPVPWGSLP LDIYLLSEWE TPHPSQPTES PSARRRRLIR QFLALGLEGR        60
     RPYQARTETP PTPTKAQIAE ILLPVRPEAL RPYAAYTTCL EEGLWLRLCY KKEEAHESIW       120
     SHNEDVAYVG PDGVVLDDEE IFGGLDLAAA LEIFPERVTN GGSSGHIKLR EETLREILGD       180
     LEDDTGSGEE DYSDDIKEKV AEFRASRAKN PLLKYGLYHA ACVVTHAFVE DEVALDGGGL       240
     LHVFWDDCGN VVRQWRVEDD GAEDNFDGAW AEGAWKENFI NGIGELGPAY HEGGMRGPPY       300
     NV                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page