(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE334

PENCW_13.PE334       Location/Qualifiers
FT   CDS             join(755459..755505,755557..755758,755818..755895)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947695"
FT                   /orf_name="Pc16g03340"
FT                   /product="Pc16g03340 protein"
FT                   /biological_process="cell wall macromolecule catabolic
FT                   process"
FT                   /protein_id="CAP93004.1"
FT                   /db_xref="GO:0016998"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="UniParc:UPI0001831E9E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H934"
FT                   /transl_table=1
FT                   /translation="MGALTWRMGITSHLTISVWNPAVGEGCGSLKIEYYVCVGVSGDMI
FT                   PSTTAKKTTTTSDGGRVTVVPGDGCYDVAADHGISLTNFYSWNPSVRDDCSELKFDSYA
FT                   CVGI"
     MGALTWRMGI TSHLTISVWN PAVGEGCGSL KIEYYVCVGV SGDMIPSTTA KKTTTTSDGG        60
     RVTVVPGDGC YDVAADHGIS LTNFYSWNPS VRDDCSELKF DSYACVGI                    108
//

If you have problems or comments...

PBIL Back to PBIL home page