(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE335

PENCW_13.PE335       Location/Qualifiers
FT   CDS             join(756722..756849,756930..757082,757142..757603,
FT                   757695..758634)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178476" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671659"
FT                   /orf_name="Pc16g03350"
FT                   /product="Pc16g03350 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP93005.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831E9F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H935"
FT                   /transl_table=1
FT                   /translation="MADQDEIRGNSVYEPEQPVTETSSPVEKPVAPKEQKKSGLMAKIG
FT                   RMLNQDVSEEMPAYKDIQIHTWDGPDDPENPFNWSLKYKWLLTITVCFISILTGLPAGT
FT                   YGSGNDWMGKEFNVQNEPFPNLYWATTSWNMGAAFWPLIFVPLTEASGRMPGYFVAYVI
FT                   LVISLFPSAFAKNFATLVVTRFFGGGASSVSINIVGGSISDVWLGDHARSLPMSIFGFT
FT                   SVVGIALGPFIGSAIVQIQKSEPWRWIFYVQIIYNAALIPVFWLILNETRPDVILKKRA
FT                   RKIRKETNLPVYAAAEIDAPSKLRLLKISFQRPTSMLLTEPVVTFFTLWISFAWGILYL
FT                   FFSSVVQTYSTNYGWGTLSTGLVQLAISVGAIIGTMINPLQDWYYLRSSRRNKEKPGKP
FT                   IPEARLYTSIPGSLLFAAGLFWYGWASQPDIHWIVPTIGITAAGIGIYSIYMAVVNYLT
FT                   DAYERYAASALSAASLGRNAFGAFLPLASPQLFSNLGFGWAGTLLGFIGIALSVVPVIL
FT                   VWKGPQIRERSKFMREAMWEPEEKVEVDRSGKEDLGPSAEGVA"
     MADQDEIRGN SVYEPEQPVT ETSSPVEKPV APKEQKKSGL MAKIGRMLNQ DVSEEMPAYK        60
     DIQIHTWDGP DDPENPFNWS LKYKWLLTIT VCFISILTGL PAGTYGSGND WMGKEFNVQN       120
     EPFPNLYWAT TSWNMGAAFW PLIFVPLTEA SGRMPGYFVA YVILVISLFP SAFAKNFATL       180
     VVTRFFGGGA SSVSINIVGG SISDVWLGDH ARSLPMSIFG FTSVVGIALG PFIGSAIVQI       240
     QKSEPWRWIF YVQIIYNAAL IPVFWLILNE TRPDVILKKR ARKIRKETNL PVYAAAEIDA       300
     PSKLRLLKIS FQRPTSMLLT EPVVTFFTLW ISFAWGILYL FFSSVVQTYS TNYGWGTLST       360
     GLVQLAISVG AIIGTMINPL QDWYYLRSSR RNKEKPGKPI PEARLYTSIP GSLLFAAGLF       420
     WYGWASQPDI HWIVPTIGIT AAGIGIYSIY MAVVNYLTDA YERYAASALS AASLGRNAFG       480
     AFLPLASPQL FSNLGFGWAG TLLGFIGIAL SVVPVILVWK GPQIRERSKF MREAMWEPEE       540
     KVEVDRSGKE DLGPSAEGVA                                                   560
//

If you have problems or comments...

PBIL Back to PBIL home page