(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE336

PENCW_13.PE336       Location/Qualifiers
FT   CDS             join(complement(760170..760291),complement(759964..759993),
FT                   complement(759809..759895),complement(759033..759747))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000168307" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947696"
FT                   /orf_name="Pc16g03360"
FT                   /product="Pc16g03360 protein"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAP93006.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI0001831EA0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H936"
FT                   /transl_table=1
FT                   /translation="MSETAQKPLPFVYQFAAGAVAGVSEVCVSCFRFEKRFRLDSYPLD
FT                   VLKTRIQLQTGAPVPGVDHYNGMFDCFRKIVKNEGASRLYRGISAPILMEAPKRATKFA
FT                   ANDSWGAFYRNLFGVDKQTQSLATLTGATAGATEAFVVVPFELVKIRLQDKAQAHKYNG
FT                   MFDVVKKIVAAEGPLAMYNGLESTMWRHVLWNAGYFGCIFQVRAQLPAVEPGNKNQQMR
FT                   NDLIAGSIGGTTGTILNTPMDVVKSRIQNTTKVPGQVAKYNWAWPALGTVMKEEGFSAL
FT                   YKGFTPKVLRLGPGGGILLVVYTGVMDFFRKMRDGN"
     MSETAQKPLP FVYQFAAGAV AGVSEVCVSC FRFEKRFRLD SYPLDVLKTR IQLQTGAPVP        60
     GVDHYNGMFD CFRKIVKNEG ASRLYRGISA PILMEAPKRA TKFAANDSWG AFYRNLFGVD       120
     KQTQSLATLT GATAGATEAF VVVPFELVKI RLQDKAQAHK YNGMFDVVKK IVAAEGPLAM       180
     YNGLESTMWR HVLWNAGYFG CIFQVRAQLP AVEPGNKNQQ MRNDLIAGSI GGTTGTILNT       240
     PMDVVKSRIQ NTTKVPGQVA KYNWAWPALG TVMKEEGFSA LYKGFTPKVL RLGPGGGILL       300
     VVYTGVMDFF RKMRDGN                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page