(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE337

PENCW_13.PE337       Location/Qualifiers
FT   CDS             join(complement(761381..762050),complement(760674..761293))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000208295" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824339"
FT                   /orf_name="Pc16g03370"
FT                   /product="Pc16g03370 protein"
FT                   /protein_id="CAP93007.1"
FT                   /db_xref="UniParc:UPI0001831EA1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H937"
FT                   /transl_table=1
FT                   /translation="MQILHALTVFCSLPQFATLISAEKINPSGDQESKEAETPLPASLI
FT                   LRRNAAIASQLAAGPALGVKKMSDDEGEKFFLDYWSFGNDSSSGNITEGHVSDDGFSPA
FT                   RFVAQSYPFAPSYSLGTDGDSQFLPWENSHSANNLLEKRDFKCPAGTWACTSIGRSDRC
FT                   CGSGETCEIVADTGHGDVGCCPSWKTCSGMIGSCQSGYTACSQALGGGCCIPGYDCVEG
FT                   GCAYITTITVTLHSTVMLSTVTYSTKPQDTTSTSASFSFPTTSSHSSKTTTNDGLAPPA
FT                   RPTNLSTVTSATRGDDVCPTGFYACSAVYHGGCCRTGRDCDTTSCPTISSTTVVSDGVT
FT                   IVAPAATTTEHTSGNRCAHGWFHCADTVGGGCCPMGFACGSSCTARDTAFATTVAKEQA
FT                   TASSGGSVVHRVSKMMLGMMIGMSVGVWIL"
     MQILHALTVF CSLPQFATLI SAEKINPSGD QESKEAETPL PASLILRRNA AIASQLAAGP        60
     ALGVKKMSDD EGEKFFLDYW SFGNDSSSGN ITEGHVSDDG FSPARFVAQS YPFAPSYSLG       120
     TDGDSQFLPW ENSHSANNLL EKRDFKCPAG TWACTSIGRS DRCCGSGETC EIVADTGHGD       180
     VGCCPSWKTC SGMIGSCQSG YTACSQALGG GCCIPGYDCV EGGCAYITTI TVTLHSTVML       240
     STVTYSTKPQ DTTSTSASFS FPTTSSHSSK TTTNDGLAPP ARPTNLSTVT SATRGDDVCP       300
     TGFYACSAVY HGGCCRTGRD CDTTSCPTIS STTVVSDGVT IVAPAATTTE HTSGNRCAHG       360
     WFHCADTVGG GCCPMGFACG SSCTARDTAF ATTVAKEQAT ASSGGSVVHR VSKMMLGMMI       420
     GMSVGVWIL                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page