(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE338

PENCW_13.PE338       Location/Qualifiers
FT   CDS             join(complement(765945..766010),complement(764848..765850),
FT                   complement(762896..764691))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208306" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824340"
FT                   /orf_name="Pc16g03380"
FT                   /product="Pc16g03380 protein"
FT                   /protein_id="CAP93008.1"
FT                   /db_xref="InterPro:IPR005613"
FT                   /db_xref="InterPro:IPR022782"
FT                   /db_xref="UniParc:UPI0001831EA2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H938"
FT                   /transl_table=1
FT                   /translation="MASQQSGRSSSASSRSQSSKSQIEKSVTHLLVATKQLLETLTQWS
FT                   RKQASENDVSDVYVRLGYEFNLACRAFSAIGVDTSDLGPVPDLLRTILEDTLSQDASSQ
FT                   SLDRYLPRIRDIIINLLKGLKKKQARLRSRHQREDGRPVPGRQASAGSIASGQAIGQLY
FT                   DEAAASTMPSTAQSTSQSPRRSNRRYGSGGSLEDQPAIARTSSAPSTSEPRANFTERET
FT                   SRREAQQMLSQPTPFDNDTTPRANAPNNTAPSTYITPTGFSAPPPPPPPKEDDALGALQ
FT                   RSGELERRASRRFSAYQIQKHLGTSTNGVPVLPTQNSPIPNRGRDVRESLNAVRLRGSF
FT                   AHTRQRSNNRLQEAAKMEATIVPPPIIPVPQEKPTLEDAFEPAKPTPQTPKGDSFGPSA
FT                   EVGTPLSAIQFATEQPSPGKELTLFLQYKSKIKKYVLPEGIAELTIGRLQLAFIEKFAW
FT                   NTHDNGVDLPEIYIQDPISGIRHELEDLADVKDRSVLVLNVDNLDEVKKHFDDSLGSVR
FT                   LLVEGVKETLSGQGNIIQRVSDRQLEAAKEIARLAASPPANSAPAAIGGNSKASIAGSG
FT                   SQIAELQSLRRDLAVLRQTYSNFTADITGSMSAVRAKASKVRTAADDVATPSYEGDAGR
FT                   ARVNTGKKELAAESERLVARVDDLQDLVEDLRKDVVTRGVRPLPRQLEGVSRDISMVMK
FT                   EIKKMQDFLGREKPIWTKIWEKELQLVCEERDQLTMQEDLAADLQDDLEKATQTFALVE
FT                   QATKEQVLTNATGGTAVRAPSRTLGIDPTIDPMKAKDGVLGEVRALQPNHESRLEAIER
FT                   AEKARKKELETRRIGLFQKELGAFVEEGKLKKSGGFEETERLRTAKDDRIRKEVWDRQQ
FT                   ARNAEMEKAEAEAAAAQAAEQNKEGEGDDDQQEGEKEVTREDGDEAEEAAEKAEEPKSP
FT                   SSDAAKPLPKSPEEDNGTSEQPSA"
     MASQQSGRSS SASSRSQSSK SQIEKSVTHL LVATKQLLET LTQWSRKQAS ENDVSDVYVR        60
     LGYEFNLACR AFSAIGVDTS DLGPVPDLLR TILEDTLSQD ASSQSLDRYL PRIRDIIINL       120
     LKGLKKKQAR LRSRHQREDG RPVPGRQASA GSIASGQAIG QLYDEAAAST MPSTAQSTSQ       180
     SPRRSNRRYG SGGSLEDQPA IARTSSAPST SEPRANFTER ETSRREAQQM LSQPTPFDND       240
     TTPRANAPNN TAPSTYITPT GFSAPPPPPP PKEDDALGAL QRSGELERRA SRRFSAYQIQ       300
     KHLGTSTNGV PVLPTQNSPI PNRGRDVRES LNAVRLRGSF AHTRQRSNNR LQEAAKMEAT       360
     IVPPPIIPVP QEKPTLEDAF EPAKPTPQTP KGDSFGPSAE VGTPLSAIQF ATEQPSPGKE       420
     LTLFLQYKSK IKKYVLPEGI AELTIGRLQL AFIEKFAWNT HDNGVDLPEI YIQDPISGIR       480
     HELEDLADVK DRSVLVLNVD NLDEVKKHFD DSLGSVRLLV EGVKETLSGQ GNIIQRVSDR       540
     QLEAAKEIAR LAASPPANSA PAAIGGNSKA SIAGSGSQIA ELQSLRRDLA VLRQTYSNFT       600
     ADITGSMSAV RAKASKVRTA ADDVATPSYE GDAGRARVNT GKKELAAESE RLVARVDDLQ       660
     DLVEDLRKDV VTRGVRPLPR QLEGVSRDIS MVMKEIKKMQ DFLGREKPIW TKIWEKELQL       720
     VCEERDQLTM QEDLAADLQD DLEKATQTFA LVEQATKEQV LTNATGGTAV RAPSRTLGID       780
     PTIDPMKAKD GVLGEVRALQ PNHESRLEAI ERAEKARKKE LETRRIGLFQ KELGAFVEEG       840
     KLKKSGGFEE TERLRTAKDD RIRKEVWDRQ QARNAEMEKA EAEAAAAQAA EQNKEGEGDD       900
     DQQEGEKEVT REDGDEAEEA AEKAEEPKSP SSDAAKPLPK SPEEDNGTSE QPSA             954
//

If you have problems or comments...

PBIL Back to PBIL home page