(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE34

PENCW_13.PE34        Location/Qualifiers
FT   CDS             join(74801..75681,75748..75859)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196153" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15945517"
FT                   /orf_name="Pc16g00340"
FT                   /product="Pc16g00340 protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP92704.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001831E93"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6U5"
FT                   /transl_table=1
FT                   /translation="MVNIIQPKVDPLPTGIDLTGKTVVITGASAGMGLEATKQLLRLRA
FT                   STVILAVRNVAKGEACATSLRQDRRIQTHNPNPTIKVMALDVDDYHSVQRFTKQLREEI
FT                   PVVHILILNAGIGLLKLERSASGHDRTTQVNYYSNVLLIAELLPYLQAGAEKTGFPARI
FT                   SWVGSRAHEVTSLEKKAPIKPGEGVLAHMDKEEAFVPFQRYGDSKLLCVMFMYSLAPRL
FT                   DPKKVIINMMCPGMVNTNMSDVLPMHLRLIVNVVKSFRARPVEVGGWIILNSALVVGPE
FT                   SHGKFLNDKTISDKSAFIKSPAGQEIQKKLWEETIAEIGTLTPLPAEFK"
     MVNIIQPKVD PLPTGIDLTG KTVVITGASA GMGLEATKQL LRLRASTVIL AVRNVAKGEA        60
     CATSLRQDRR IQTHNPNPTI KVMALDVDDY HSVQRFTKQL REEIPVVHIL ILNAGIGLLK       120
     LERSASGHDR TTQVNYYSNV LLIAELLPYL QAGAEKTGFP ARISWVGSRA HEVTSLEKKA       180
     PIKPGEGVLA HMDKEEAFVP FQRYGDSKLL CVMFMYSLAP RLDPKKVIIN MMCPGMVNTN       240
     MSDVLPMHLR LIVNVVKSFR ARPVEVGGWI ILNSALVVGP ESHGKFLNDK TISDKSAFIK       300
     SPAGQEIQKK LWEETIAEIG TLTPLPAEFK                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page