(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE340

PENCW_13.PE340       Location/Qualifiers
FT   CDS             join(complement(775039..775141),complement(774656..774781),
FT                   complement(774180..774448),complement(773994..774101),
FT                   complement(773758..773905),complement(773527..773666),
FT                   complement(773363..773426),complement(773044..773228),
FT                   complement(772518..772643))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947698"
FT                   /orf_name="Pc16g03400"
FT                   /product="Putative uncharacterized protein Pc16g03400 "
FT                   /protein_id="CAP93010.1"
FT                   /db_xref="UniParc:UPI0001831EA4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H940"
FT                   /transl_table=1
FT                   /translation="MWQVGDCLGCPGARVGAANGQGFNMRPVVRMRSIVNAHSHQSTVD
FT                   SPIEQSKCPVAFPRVSIQPATQVALSNDANSELCSDHDDILLRSHSRQPTSHNNIPTAW
FT                   PPLFQQNTNVSRRNAGTLQRDPSQRTHGWWPRWTKRRWSWIMGDIVYIYASVRPELVSQ
FT                   LGLVHLGIVSLKCFGDSVHRAGSMARESMGNGEAAPLSGGKVWVVGGNSYGVLGGLGVE
FT                   RILAGGVLLAMRNTGFSIVFSPTPWGGIPNGEVCWLGCGLEVFGFCDAWWCFGGLFWGL
FT                   FMAGVWAEESAMGRSTAGWFAAADICNSYLASSTSTVSGGHRSVGAICTVKFTHLQPHV
FT                   TASLAPPDRSPSSTSPFDQPSSPPRRNPLQTYFPPWKMQSPNSNVLRTASVTGKQMKTR
FT                   SWKSNRGIGVGGCQQCRARASHS"
     MWQVGDCLGC PGARVGAANG QGFNMRPVVR MRSIVNAHSH QSTVDSPIEQ SKCPVAFPRV        60
     SIQPATQVAL SNDANSELCS DHDDILLRSH SRQPTSHNNI PTAWPPLFQQ NTNVSRRNAG       120
     TLQRDPSQRT HGWWPRWTKR RWSWIMGDIV YIYASVRPEL VSQLGLVHLG IVSLKCFGDS       180
     VHRAGSMARE SMGNGEAAPL SGGKVWVVGG NSYGVLGGLG VERILAGGVL LAMRNTGFSI       240
     VFSPTPWGGI PNGEVCWLGC GLEVFGFCDA WWCFGGLFWG LFMAGVWAEE SAMGRSTAGW       300
     FAAADICNSY LASSTSTVSG GHRSVGAICT VKFTHLQPHV TASLAPPDRS PSSTSPFDQP       360
     SSPPRRNPLQ TYFPPWKMQS PNSNVLRTAS VTGKQMKTRS WKSNRGIGVG GCQQCRARAS       420
     HS                                                                      422
//

If you have problems or comments...

PBIL Back to PBIL home page