(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE344

PENCW_13.PE344       Location/Qualifiers
FT   CDS             join(complement(784730..785049),complement(784542..784560),
FT                   complement(783190..784491))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947700"
FT                   /orf_name="Pc16g03440"
FT                   /product="Pc16g03440 protein"
FT                   /protein_id="CAP93014.1"
FT                   /db_xref="UniParc:UPI0001831165"
FT                   /db_xref="UniProtKB/TrEMBL:B6H944"
FT                   /transl_table=1
FT                   /translation="MASDQRFQRTVQAVAEAVQTFAVGTFDFAESIKKIWGPQTQPDAV
FT                   ETSDPLPVEGMQDVQTVDQLRDRTPVSQDSDHLSTHSHSYPLSEAMDDGESYVMHERIA
FT                   PSEQIPCQMIPADGIGKILHYKMEAGIYLTMQNGFGQIERQRFVDVFREAAELLGISLP
FT                   SPIADLPQQQVGSKRVYQGSDDQQPVAKRQRTQDLLQEDVQGAPEDGEFSSSEEEEVAQ
FT                   IKVQLNRQERSPVKIPDQVPVVHKMTQEYVIHPEEENTGSSSFTQKESSEHSSSEEDGD
FT                   DYFSEEEEEGVQNPTKEVSQAEHNAKAKTAIRPQDEHSELSSCSSEDESSEDDSSERES
FT                   DDEAEPRQQQTTKEDSPKGPTYNSKEPIQSPDDKSSDSSAEDESSDELSEAELEEQIEK
FT                   HLATPEAFFQMEPILLEDSDAFESSASSSEDESSSEESDDEQEEPKQQPTTKEQPPNKG
FT                   GTHNSKEPIQLTNDKSSNSSSEDESSEEESGDEPEGPKKQPAVKSEPQRREERPEEPIE
FT                   VAGGESPSPSSSSSSSSEDESSEDSEIET"
     MASDQRFQRT VQAVAEAVQT FAVGTFDFAE SIKKIWGPQT QPDAVETSDP LPVEGMQDVQ        60
     TVDQLRDRTP VSQDSDHLST HSHSYPLSEA MDDGESYVMH ERIAPSEQIP CQMIPADGIG       120
     KILHYKMEAG IYLTMQNGFG QIERQRFVDV FREAAELLGI SLPSPIADLP QQQVGSKRVY       180
     QGSDDQQPVA KRQRTQDLLQ EDVQGAPEDG EFSSSEEEEV AQIKVQLNRQ ERSPVKIPDQ       240
     VPVVHKMTQE YVIHPEEENT GSSSFTQKES SEHSSSEEDG DDYFSEEEEE GVQNPTKEVS       300
     QAEHNAKAKT AIRPQDEHSE LSSCSSEDES SEDDSSERES DDEAEPRQQQ TTKEDSPKGP       360
     TYNSKEPIQS PDDKSSDSSA EDESSDELSE AELEEQIEKH LATPEAFFQM EPILLEDSDA       420
     FESSASSSED ESSSEESDDE QEEPKQQPTT KEQPPNKGGT HNSKEPIQLT NDKSSNSSSE       480
     DESSEEESGD EPEGPKKQPA VKSEPQRREE RPEEPIEVAG GESPSPSSSS SSSSEDESSE       540
     DSEIET                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page