(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE345

PENCW_13.PE345       Location/Qualifiers
FT   CDS             join(786192..786440,786504..786625,786684..787255,
FT                   787304..787932)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000169152" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947701"
FT                   /orf_name="Pc16g03450"
FT                   /product="Pc16g03450 protein"
FT                   /function="chromate transmembrane transporter activity "
FT                   /protein_id="CAP93015.1"
FT                   /db_xref="GO:0015109"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniParc:UPI0001831166"
FT                   /db_xref="UniProtKB/TrEMBL:B6H945"
FT                   /transl_table=1
FT                   /translation="MPLAPFSQALSSLARLNEKRASRVSSENEGSVKPLPTRLLDVFLR
FT                   TWDLGFTAFGGPPVHFQILHSRFVEGKGDKEKWVDEQTYQELFAICQGLPGPGSTKMVF
FT                   CLALLHAGFIPAMLVFLIWALPGAIGMYALSLGVQSMSETLPEPAYALLSGLNASTVGI
FT                   VALAAVQLAEKAIRDKISRILVIFGACAGLCYNALWYFPVLMVIGGFATTIWDGWMYQQ
FT                   FLRAKLAWKNRHHRPQQADEANGDSIAMDDTALEENGVQRSETPRSRRADRRVEGLPQN
FT                   TGNTTSPTPPVEAALQQHIIRIRVGVLIMCLFFASFIAILVARGQLAAPPLVLDLFANM
FT                   YLAGTVIFGGGPVVIPLLRSYVVDPGWVSSRDFLIGLAIIQAFPGPNFNFAVFLGALAL
FT                   QRSQFPTVFGAFLGGLGIFLPGITLAVAIQSFWRVLRKKKYVVDFLRGVNATAVGLVFT
FT                   AVYRLWEIGYLTSERNNGQSLGKEPWWVVVAAVTYSGSAWFKVPPPVAIVMGAILGLCW
FT                   YGAVGR"
     MPLAPFSQAL SSLARLNEKR ASRVSSENEG SVKPLPTRLL DVFLRTWDLG FTAFGGPPVH        60
     FQILHSRFVE GKGDKEKWVD EQTYQELFAI CQGLPGPGST KMVFCLALLH AGFIPAMLVF       120
     LIWALPGAIG MYALSLGVQS MSETLPEPAY ALLSGLNAST VGIVALAAVQ LAEKAIRDKI       180
     SRILVIFGAC AGLCYNALWY FPVLMVIGGF ATTIWDGWMY QQFLRAKLAW KNRHHRPQQA       240
     DEANGDSIAM DDTALEENGV QRSETPRSRR ADRRVEGLPQ NTGNTTSPTP PVEAALQQHI       300
     IRIRVGVLIM CLFFASFIAI LVARGQLAAP PLVLDLFANM YLAGTVIFGG GPVVIPLLRS       360
     YVVDPGWVSS RDFLIGLAII QAFPGPNFNF AVFLGALALQ RSQFPTVFGA FLGGLGIFLP       420
     GITLAVAIQS FWRVLRKKKY VVDFLRGVNA TAVGLVFTAV YRLWEIGYLT SERNNGQSLG       480
     KEPWWVVVAA VTYSGSAWFK VPPPVAIVMG AILGLCWYGA VGR                         523
//

If you have problems or comments...

PBIL Back to PBIL home page