(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE347

PENCW_13.PE347       Location/Qualifiers
FT   CDS             join(790621..791033,791093..791204)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000201293" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824343"
FT                   /orf_name="Pc16g03470"
FT                   /product="Pc16g03470 protein"
FT                   /protein_id="CAP93017.1"
FT                   /db_xref="UniParc:UPI0001831167"
FT                   /db_xref="UniProtKB/TrEMBL:B6H946"
FT                   /transl_table=1
FT                   /translation="MVHQTDMLAPPEAASFYITPEYADKLANKTIPWVRQKLDTDNLGD
FT                   RLFATSRVQEADPDDILQRNKYRTIILGALMIRAGARIKAADLQHLRDLVPQINCTSRR
FT                   MLFDHGFRTPGKVQFLAALDYYQPGVPRSFQEPSCFMCGKIEDDIGHTPLQCKKCKVAT
FT                   YCGKVSRMDTS"
     MVHQTDMLAP PEAASFYITP EYADKLANKT IPWVRQKLDT DNLGDRLFAT SRVQEADPDD        60
     ILQRNKYRTI ILGALMIRAG ARIKAADLQH LRDLVPQINC TSRRMLFDHG FRTPGKVQFL       120
     AALDYYQPGV PRSFQEPSCF MCGKIEDDIG HTPLQCKKCK VATYCGKVSR MDTS             174
//

If you have problems or comments...

PBIL Back to PBIL home page