(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE348

PENCW_13.PE348       Location/Qualifiers
FT   CDS             792281..793333
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076676" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671660"
FT                   /orf_name="Pc16g03480"
FT                   /product="Pc16g03480 protein"
FT                   /protein_id="CAP93018.1"
FT                   /db_xref="UniParc:UPI0001831168"
FT                   /db_xref="UniProtKB/TrEMBL:B6H947"
FT                   /transl_table=1
FT                   /translation="MTRLTTIFTTLYALYSLPLISAWTFVWRNAANNPTVEKGTDAQSC
FT                   KAIDHAKGKDFKFDAEDSLFRIYMYGSPNCTDDNIESAEDYLARNSTSPLRAFAVIDLR
FT                   GANTSTGGELTPFPGADWFKSSPNSPIITAMGERLVAENCGKYRVGPGPQWSEVDRESY
FT                   QCWQKKLGYTGTDANGWPGKTTWDQLKVSLTDGNDGGSSKTTETPPSATTSTATSTGTG
FT                   TGTGTPTSTSVPDTDTSSGSALSGGEIAGSVVGSVAGLGLVGAMIYLSRRIFRHRAPAS
FT                   GDEGPEPDSEGGAMAVGGSKRWAREKLPFEVEADPAKNRKKYISELPGDTAAAELSDSR
FT                   RVLELGDSRT"
     MTRLTTIFTT LYALYSLPLI SAWTFVWRNA ANNPTVEKGT DAQSCKAIDH AKGKDFKFDA        60
     EDSLFRIYMY GSPNCTDDNI ESAEDYLARN STSPLRAFAV IDLRGANTST GGELTPFPGA       120
     DWFKSSPNSP IITAMGERLV AENCGKYRVG PGPQWSEVDR ESYQCWQKKL GYTGTDANGW       180
     PGKTTWDQLK VSLTDGNDGG SSKTTETPPS ATTSTATSTG TGTGTGTPTS TSVPDTDTSS       240
     GSALSGGEIA GSVVGSVAGL GLVGAMIYLS RRIFRHRAPA SGDEGPEPDS EGGAMAVGGS       300
     KRWAREKLPF EVEADPAKNR KKYISELPGD TAAAELSDSR RVLELGDSRT                  350
//

If you have problems or comments...

PBIL Back to PBIL home page