(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE352

PENCW_13.PE352       Location/Qualifiers
FT   CDS             complement(801679..803790)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216303" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947702"
FT                   /orf_name="Pc16g03520"
FT                   /product="Pc16g03520 protein"
FT                   /function="ATP binding"
FT                   /function="two-component response regulator activity "
FT                   /function="two-component sensor activity"
FT                   /biological_process="peptidyl-histidine phosphorylation "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP93022.1"
FT                   /db_xref="GO:0000155"
FT                   /db_xref="GO:0000156"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0018106"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="UniParc:UPI0001831169"
FT                   /db_xref="UniProtKB/TrEMBL:B6H948"
FT                   /transl_table=1
FT                   /translation="MALTSGLQALTVDDTSRPACKPLITTPVGEEETAPAEPNRSSNSK
FT                   EKKMETPQECVGLDASLSRIYRYHPIPTLIVDKSLCVVEVSDSHCAFSGQSRDELVGTC
FT                   VCDVPVHTIPAPDTPTLYGALRTAIVSEKVQILDGIHVKSKNSIYQLRITPIFEKSSLI
FT                   YVVLEAQNAPQDHCVGTDEQHANMNEIYKILVDTMKDYAIFMLDTRGNVTTWNLGAELL
FT                   KGYSPSEIIGKHFSIFYSPADLDIDKPGRGLARALRQGRMEDEGWRYRQDGSRFWANVL
FT                   ITPIYQLGRHMGFVKVTRDLTERKAAEQRMIVAFEESAKMKTDFLANMSHELRTPMNGM
FT                   QLALAMMKDSDLTEQQLEYASIIEDSTSVLLRIINDVLDYSKLSSGSFSLHSDVVEIKG
FT                   ILDAVMRNCRSLLKPGVELSCLIPPDLPKFMRGDPLRYRQVIQNMLGNSVKFTETGYIR
FT                   VSTTFSPVESDPETYTVTTEFADSGVGIPDCALNTLFTPFTRFADSSTRKYQGTGLGLS
FT                   ICKSLAELMDGTVGYRPGPQNKGSVFWFTARMGRVGTGYSNAQPAIPSTDDAKDLLNRV
FT                   RGIAPRKRVLLVEDNLVNQTVMLKLLQSLEFERIDVAGDGAEAVRQVKQTPLSYNVVLM
FT                   DISMPVTDGLEATSQIRGMGIDVPIVALTANALKGDMETYLANGMNDYIGKPVNRDQLL
FT                   QVLWKWIGA"
     MALTSGLQAL TVDDTSRPAC KPLITTPVGE EETAPAEPNR SSNSKEKKME TPQECVGLDA        60
     SLSRIYRYHP IPTLIVDKSL CVVEVSDSHC AFSGQSRDEL VGTCVCDVPV HTIPAPDTPT       120
     LYGALRTAIV SEKVQILDGI HVKSKNSIYQ LRITPIFEKS SLIYVVLEAQ NAPQDHCVGT       180
     DEQHANMNEI YKILVDTMKD YAIFMLDTRG NVTTWNLGAE LLKGYSPSEI IGKHFSIFYS       240
     PADLDIDKPG RGLARALRQG RMEDEGWRYR QDGSRFWANV LITPIYQLGR HMGFVKVTRD       300
     LTERKAAEQR MIVAFEESAK MKTDFLANMS HELRTPMNGM QLALAMMKDS DLTEQQLEYA       360
     SIIEDSTSVL LRIINDVLDY SKLSSGSFSL HSDVVEIKGI LDAVMRNCRS LLKPGVELSC       420
     LIPPDLPKFM RGDPLRYRQV IQNMLGNSVK FTETGYIRVS TTFSPVESDP ETYTVTTEFA       480
     DSGVGIPDCA LNTLFTPFTR FADSSTRKYQ GTGLGLSICK SLAELMDGTV GYRPGPQNKG       540
     SVFWFTARMG RVGTGYSNAQ PAIPSTDDAK DLLNRVRGIA PRKRVLLVED NLVNQTVMLK       600
     LLQSLEFERI DVAGDGAEAV RQVKQTPLSY NVVLMDISMP VTDGLEATSQ IRGMGIDVPI       660
     VALTANALKG DMETYLANGM NDYIGKPVNR DQLLQVLWKW IGA                         703
//

If you have problems or comments...

PBIL Back to PBIL home page