(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE358

PENCW_13.PE358       Location/Qualifiers
FT   CDS             816215..816769
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947705"
FT                   /orf_name="Pc16g03580"
FT                   /product="Pc16g03580 protein"
FT                   /protein_id="CAP93028.1"
FT                   /db_xref="UniParc:UPI000183116D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7S3"
FT                   /transl_table=1
FT                   /translation="MRFTFAPDTFRLISHTQWLQTGFNLVLGCKLAVTGAKYAPRSPHV
FT                   RDLCSALNMPGVLRAALQRIQWLSKDRVTVDGKQHSKYFYEAWLCRILVWFEQKYHLVP
FT                   SEDTTQISTGPSTLANSATSQDVPLTGENYGATQVAQVDDTALWPDFLWNISTDDILNG
FT                   YMGFPDMPYPTLQPGYHVPLP"
     MRFTFAPDTF RLISHTQWLQ TGFNLVLGCK LAVTGAKYAP RSPHVRDLCS ALNMPGVLRA        60
     ALQRIQWLSK DRVTVDGKQH SKYFYEAWLC RILVWFEQKY HLVPSEDTTQ ISTGPSTLAN       120
     SATSQDVPLT GENYGATQVA QVDDTALWPD FLWNISTDDI LNGYMGFPDM PYPTLQPGYH       180
     VPLP                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page