(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE360

PENCW_13.PE360       Location/Qualifiers
FT   CDS             join(complement(817906..818299),complement(817614..817837))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000158505" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977572"
FT                   /orf_name="Pc16g03600"
FT                   /product="Pc16g03600 protein"
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="CAP93030.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI000183116E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7S4"
FT                   /transl_table=1
FT                   /translation="MGSATNSLVLELATPEDIPAITEVWFASFTQPVIGKLFPNTPGMH
FT                   QWHRDWHLGDIQKPHHRYLRVVDTESKDEQGRPRLVAFGKWDLAMPDERGRRFPQWHAD
FT                   SPYQECEDFIAELEQARKRVMGDEKHYYLDTLGTHPDYQRRGAGSMLVQWGCDLADKDG
FT                   VAAYVDASKEGASLYLKHGFVNFNPPGSDVAAMARRKAAPSC"
     MGSATNSLVL ELATPEDIPA ITEVWFASFT QPVIGKLFPN TPGMHQWHRD WHLGDIQKPH        60
     HRYLRVVDTE SKDEQGRPRL VAFGKWDLAM PDERGRRFPQ WHADSPYQEC EDFIAELEQA       120
     RKRVMGDEKH YYLDTLGTHP DYQRRGAGSM LVQWGCDLAD KDGVAAYVDA SKEGASLYLK       180
     HGFVNFNPPG SDVAAMARRK AAPSC                                             205
//

If you have problems or comments...

PBIL Back to PBIL home page