(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE361

PENCW_13.PE361       Location/Qualifiers
FT   CDS             818395..818739
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947706"
FT                   /orf_name="Pc16g03610"
FT                   /product="Putative uncharacterized protein Pc16g03610 "
FT                   /protein_id="CAP93031.1"
FT                   /db_xref="UniParc:UPI000183116F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7S5"
FT                   /transl_table=1
FT                   /translation="MGNGWGMFPGEIWPRDENKTRLMVAGDMGMGFKGRVGQGHIKRKR
FT                   EETGADKRVAMGAWIYNSSNDKDTLKNAAYARGLAACRDEDFCFGPRQPHVSSYDALNH
FT                   DFPMEPGPQG"
     MGNGWGMFPG EIWPRDENKT RLMVAGDMGM GFKGRVGQGH IKRKREETGA DKRVAMGAWI        60
     YNSSNDKDTL KNAAYARGLA ACRDEDFCFG PRQPHVSSYD ALNHDFPMEP GPQG             114
//

If you have problems or comments...

PBIL Back to PBIL home page