(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE362

PENCW_13.PE362       Location/Qualifiers
FT   CDS             join(complement(819915..820181),complement(819614..819838),
FT                   complement(818882..819316))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947707"
FT                   /orf_name="Pc16g03620"
FT                   /product="Pc16g03620 protein"
FT                   /protein_id="CAP93032.1"
FT                   /db_xref="UniParc:UPI0001831170"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7S6"
FT                   /transl_table=1
FT                   /translation="MGTRFKDDTKDPAVNVTNWVLLVTIIFSVSARLGTKIRLFKRLTT
FT                   DDLLIIASLVFGIGQSIVVSLAVGSGYGKHFKDVSSADMQQVMKNLFAGSVLYLLSLTF
FT                   SKLSLVVFIRSLTPSAKDKWLARGVETIVYVWALVTIFGTAFQCSLPRTWDFQSGHCFN
FT                   LCDDRNNWRDRHPQEKHERQRSNISDVRNHHFRSDHAVPQYCDGLLGTTEPLPVLDAIE
FT                   RAQALWRGRPDFLELQDALAITRAVQVARSQEQIRKPRDLPSVYATRSNSGHAGLGGRQ
FT                   SVKPGAHNGVANTPLGYHELQVADHLS"
     MGTRFKDDTK DPAVNVTNWV LLVTIIFSVS ARLGTKIRLF KRLTTDDLLI IASLVFGIGQ        60
     SIVVSLAVGS GYGKHFKDVS SADMQQVMKN LFAGSVLYLL SLTFSKLSLV VFIRSLTPSA       120
     KDKWLARGVE TIVYVWALVT IFGTAFQCSL PRTWDFQSGH CFNLCDDRNN WRDRHPQEKH       180
     ERQRSNISDV RNHHFRSDHA VPQYCDGLLG TTEPLPVLDA IERAQALWRG RPDFLELQDA       240
     LAITRAVQVA RSQEQIRKPR DLPSVYATRS NSGHAGLGGR QSVKPGAHNG VANTPLGYHE       300
     LQVADHLS                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page