(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE363

PENCW_13.PE363       Location/Qualifiers
FT   CDS             join(821097..821207,821264..821334,821415..821558,
FT                   821616..821698,821761..822158,822220..822552,8
FT                   22606..823088)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162166" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947708"
FT                   /orf_name="Pc16g03630"
FT                   /product="Pc16g03630 protein"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP93033.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0001831171"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7S7"
FT                   /transl_table=1
FT                   /translation="MVAYEFKTTTSVTSRGGGPVDRDNAHLQRMGKRPVLKRNFGILSI
FT                   LGFSCTILGTWEGLLGVFPYPKPAVLQRSLTDISGGSGGAIYAYIFGWVGCFANFMVLS
FT                   ELASMAPTAGGQYHWAAMLAPGRLQKFLSFITGWFAVLGWQSAFAACAFLTGKMIQGAA
FT                   ILGNNLYNALPWEGTLIVWGSLSLALAVNLVGGNLLPRIEVIILVVHILGFFGIIIPLV
FT                   YMADHNTKEQAFLSFQNGGGFATQGLSWFVGMTSCAFAFAGGDAAVHMSEEVANASTVI
FT                   PNALMISVGINGCLGFGMIIVMMFCTDSDLGGKLGKITGYNFMGIFMEATDSVPGSLTM
FT                   ISIVIIIYVCSLMGLLAAASRQLWSFSRDRGVPGWRLWSQISSTRQLPIFAILLTVTVA
FT                   TLLSLINIGSNTAMEDIVSMAVAGIYLSYLMVSVLLFYRRVRGDISRYNDNEDDIVNVP
FT                   GAKLVWGPFHCPGIVGTVINGYAIIYLTIVVFFSFWPSTMDPTVETMNWSVLAIGGSSL
FT                   LAVIYYVVHARHIYKGPVMEVSL"
     MVAYEFKTTT SVTSRGGGPV DRDNAHLQRM GKRPVLKRNF GILSILGFSC TILGTWEGLL        60
     GVFPYPKPAV LQRSLTDISG GSGGAIYAYI FGWVGCFANF MVLSELASMA PTAGGQYHWA       120
     AMLAPGRLQK FLSFITGWFA VLGWQSAFAA CAFLTGKMIQ GAAILGNNLY NALPWEGTLI       180
     VWGSLSLALA VNLVGGNLLP RIEVIILVVH ILGFFGIIIP LVYMADHNTK EQAFLSFQNG       240
     GGFATQGLSW FVGMTSCAFA FAGGDAAVHM SEEVANASTV IPNALMISVG INGCLGFGMI       300
     IVMMFCTDSD LGGKLGKITG YNFMGIFMEA TDSVPGSLTM ISIVIIIYVC SLMGLLAAAS       360
     RQLWSFSRDR GVPGWRLWSQ ISSTRQLPIF AILLTVTVAT LLSLINIGSN TAMEDIVSMA       420
     VAGIYLSYLM VSVLLFYRRV RGDISRYNDN EDDIVNVPGA KLVWGPFHCP GIVGTVINGY       480
     AIIYLTIVVF FSFWPSTMDP TVETMNWSVL AIGGSSLLAV IYYVVHARHI YKGPVMEVSL       540
//

If you have problems or comments...

PBIL Back to PBIL home page