(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE364

PENCW_13.PE364       Location/Qualifiers
FT   CDS             join(complement(824584..824783),complement(824502..824530),
FT                   complement(824323..824449),complement(824138..824265),
FT                   complement(823977..824077))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000169930" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671661"
FT                   /orf_name="Pc16g03640"
FT                   /product="Pc16g03640 protein"
FT                   /protein_id="CAP93034.1"
FT                   /db_xref="UniParc:UPI0001831172"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7S8"
FT                   /transl_table=1
FT                   /translation="MQLLSLFTSLALVSAVVSSPAADLNVNVARADDQHGSYIVSGLGA
FT                   RKQEILKAGGNTRDMAIAMLETDNMTTDYKYGDGKTGDGTNFGVFKQNWFILRNSAADF
FT                   LGQTVDQVDNGVILNTDLAKDIKARHEGEAKYGYEKWFSGHRNGETGLKNPGTDDIKTY
FT                   MSGVAWIQQQLESDEKYQSDDTRFYVQVVAI"
     MQLLSLFTSL ALVSAVVSSP AADLNVNVAR ADDQHGSYIV SGLGARKQEI LKAGGNTRDM        60
     AIAMLETDNM TTDYKYGDGK TGDGTNFGVF KQNWFILRNS AADFLGQTVD QVDNGVILNT       120
     DLAKDIKARH EGEAKYGYEK WFSGHRNGET GLKNPGTDDI KTYMSGVAWI QQQLESDEKY       180
     QSDDTRFYVQ VVAI                                                         194
//

If you have problems or comments...

PBIL Back to PBIL home page