(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE365

PENCW_13.PE365       Location/Qualifiers
FT   CDS             join(complement(828058..828241),complement(827690..827995),
FT                   complement(826805..827637),complement(826476..826751))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000202868" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947709"
FT                   /orf_name="Pc16g03650"
FT                   /product="Pc16g03650 protein"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP93035.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831173"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7S9"
FT                   /transl_table=1
FT                   /translation="MSLDKEEKQLEDISKDNVEQIEHAEHFDLKDQSDLSSIEATAASK
FT                   TAWLICIVVSIGGLLFGYDTGYISAVLVTIGSSLGHVLSSSEQEMVTSLTSGGALVGAV
FT                   GAGLTADRFGRRLPIWGACVVFVIGTALQTAAFSVGQFATGRFVVGLGVGSASMIVPLY
FT                   IGELAPAQYRGRMVAFNNMSVTFGQFLASALGAGFAEAKGEAWRATVGLGAAPALALAG
FT                   LLFVCPESPRQLVTHGKREAAEAVLLRIYPTSTVGQRQAKIRSIELSLQEVSMDKESLW
FT                   VTFKRIFTTPSTGRAVLTACMIMAISQLGGFNTLMYYAATLFSIVGFSNATAVGITVSG
FT                   TNFVFSILNLLLVDKFGRRIILTITVLGMSLCMIVAVIAFRYIPIDTETLVVESNNIGW
FT                   PGILVLVAIICYVACYSSGVATIAWIGTELIPLEVRAMGTMLNTVTCWSTNIIISSTFL
FT                   SMMKAWTPSGAFGFYAGICFFGWVFVVFFYPECKGMPLEAVREVFSTGFGVRYSKKWQK
FT                   DHKDDVKVQTIVLGH"
     MSLDKEEKQL EDISKDNVEQ IEHAEHFDLK DQSDLSSIEA TAASKTAWLI CIVVSIGGLL        60
     FGYDTGYISA VLVTIGSSLG HVLSSSEQEM VTSLTSGGAL VGAVGAGLTA DRFGRRLPIW       120
     GACVVFVIGT ALQTAAFSVG QFATGRFVVG LGVGSASMIV PLYIGELAPA QYRGRMVAFN       180
     NMSVTFGQFL ASALGAGFAE AKGEAWRATV GLGAAPALAL AGLLFVCPES PRQLVTHGKR       240
     EAAEAVLLRI YPTSTVGQRQ AKIRSIELSL QEVSMDKESL WVTFKRIFTT PSTGRAVLTA       300
     CMIMAISQLG GFNTLMYYAA TLFSIVGFSN ATAVGITVSG TNFVFSILNL LLVDKFGRRI       360
     ILTITVLGMS LCMIVAVIAF RYIPIDTETL VVESNNIGWP GILVLVAIIC YVACYSSGVA       420
     TIAWIGTELI PLEVRAMGTM LNTVTCWSTN IIISSTFLSM MKAWTPSGAF GFYAGICFFG       480
     WVFVVFFYPE CKGMPLEAVR EVFSTGFGVR YSKKWQKDHK DDVKVQTIVL GH               532
//

If you have problems or comments...

PBIL Back to PBIL home page