(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE366

PENCW_13.PE366       Location/Qualifiers
FT   CDS             join(829700..829947,830003..830340,830400..830719,
FT                   830775..831015,831075..831265)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000158981" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947710"
FT                   /orf_name="Pc16g03660"
FT                   /product="Pc16g03660 protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP93036.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0001831174"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7T0"
FT                   /transl_table=1
FT                   /translation="MNTIRPSIPRLSALLRKKPFPTPSPGPPLLPGILIDEEISPVYDS
FT                   KYFYPAKPGEVLADRYQILVKVGWGVSSTVWLARDLQGHFEESESVVALKIANSNASSA
FT                   GHEREVEEHISTADPSHRGRSLIRTLLDSFEIKGSEGSYSCLVYPPMREPLSMYQRRFG
FT                   DRKMPLPLIKTYIRALLTGLDYLHQKCRIVHTDLKLENIMVSFEDATVLADFMDSQLER
FT                   PMAFKIDSTGRPVYQSRSDFGPLKSLSSIPQLVDFGLATRLEEDDDWGVWPIQPDHYRA
FT                   PEVILGNGWQMPADIWNLGVLLWDMIEGKELFQHIHDQQGRYDAKLHIAEMIALLGPPH
FT                   PEVIQRYQFMREYSWPQPVRREDGRLCETAEEYFGGPFFDNNGRFLYEDMIPDWKLGDT
FT                   VSFLEGEEREAFLDLAKQMLVWHPNIRKTAGQLAGHPFLQLKQTSV"
     MNTIRPSIPR LSALLRKKPF PTPSPGPPLL PGILIDEEIS PVYDSKYFYP AKPGEVLADR        60
     YQILVKVGWG VSSTVWLARD LQGHFEESES VVALKIANSN ASSAGHEREV EEHISTADPS       120
     HRGRSLIRTL LDSFEIKGSE GSYSCLVYPP MREPLSMYQR RFGDRKMPLP LIKTYIRALL       180
     TGLDYLHQKC RIVHTDLKLE NIMVSFEDAT VLADFMDSQL ERPMAFKIDS TGRPVYQSRS       240
     DFGPLKSLSS IPQLVDFGLA TRLEEDDDWG VWPIQPDHYR APEVILGNGW QMPADIWNLG       300
     VLLWDMIEGK ELFQHIHDQQ GRYDAKLHIA EMIALLGPPH PEVIQRYQFM REYSWPQPVR       360
     REDGRLCETA EEYFGGPFFD NNGRFLYEDM IPDWKLGDTV SFLEGEEREA FLDLAKQMLV       420
     WHPNIRKTAG QLAGHPFLQL KQTSV                                             445
//

If you have problems or comments...

PBIL Back to PBIL home page