(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE369

PENCW_13.PE369       Location/Qualifiers
FT   CDS             839511..839990
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671662"
FT                   /orf_name="Pc16g03690"
FT                   /product="Putative uncharacterized protein Pc16g03690 "
FT                   /protein_id="CAP93039.1"
FT                   /db_xref="UniParc:UPI000183124B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7T3"
FT                   /transl_table=1
FT                   /translation="MPTGVGTIQFSAHWRPMPPTERQLRSCILLAYQLLTYFDNAKNPH
FT                   QELQAPELTNDIIYITHTYDTPHLPKENPFPADWLLRRELAKTIREFQRLVAVIPSKRF
FT                   PPEAVLKRPISSDQHEAQKHGRYPSQSGITQITCVSYDSCKGLAKSLAAITYFHR"
     MPTGVGTIQF SAHWRPMPPT ERQLRSCILL AYQLLTYFDN AKNPHQELQA PELTNDIIYI        60
     THTYDTPHLP KENPFPADWL LRRELAKTIR EFQRLVAVIP SKRFPPEAVL KRPISSDQHE       120
     AQKHGRYPSQ SGITQITCVS YDSCKGLAKS LAAITYFHR                              159
//

If you have problems or comments...

PBIL Back to PBIL home page