(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE371

PENCW_13.PE371       Location/Qualifiers
FT   CDS             join(complement(842024..842547),complement(841895..841969),
FT                   complement(841684..841846))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076659" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671664"
FT                   /orf_name="Pc16g03710"
FT                   /product="Pc16g03710 protein"
FT                   /protein_id="CAP93041.1"
FT                   /db_xref="UniParc:UPI000183124D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7T6"
FT                   /transl_table=1
FT                   /translation="MSSLESPTRPESPVDVVDVGPSRWAIVSKLQERTNILSQQDVTDG
FT                   LGPAYVTEKFLCSSLDSSNTPAFMRVYKQVPIAGTEIKKASVRAAQAVKSYEPIELVAL
FT                   KSLQEKGCDVIPRLLAYQCDEQAEDDTVPGGFIAYVIWEKVPGESLNTQKFWGYSLSER
FT                   EEIRLKFREAYKAVQACGYGLFPGIKKIIYHRPTQTIYLSGFSGPYRTEDTQWSDDIYC
FT                   AYGLVRPPTALDQIFPITSTDLKYDDKGWRW"
     MSSLESPTRP ESPVDVVDVG PSRWAIVSKL QERTNILSQQ DVTDGLGPAY VTEKFLCSSL        60
     DSSNTPAFMR VYKQVPIAGT EIKKASVRAA QAVKSYEPIE LVALKSLQEK GCDVIPRLLA       120
     YQCDEQAEDD TVPGGFIAYV IWEKVPGESL NTQKFWGYSL SEREEIRLKF REAYKAVQAC       180
     GYGLFPGIKK IIYHRPTQTI YLSGFSGPYR TEDTQWSDDI YCAYGLVRPP TALDQIFPIT       240
     STDLKYDDKG WRW                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page