(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE372

PENCW_13.PE372       Location/Qualifiers
FT   CDS             join(842863..843022,843107..843179,843256..843333,
FT                   843379..843498,843634..843799)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977574"
FT                   /orf_name="Pc16g03720"
FT                   /product="Putative uncharacterized protein Pc16g03720 "
FT                   /protein_id="CAP93042.1"
FT                   /db_xref="UniParc:UPI000183124E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7T7"
FT                   /transl_table=1
FT                   /translation="MGIFEDHDSSLRLGTFGSFAEVIGGVNTRPNSLSECDLQGVDGGL
FT                   RRPAAPAAVLLEVMIPLAALRSSLFDIWVQVRGDARQQARAGRNYTALLVRSTDSYHMR
FT                   GHCSSGNCRTTAGRLLPQSESGLIRHLRRGYRYARRVACQGQGSNRTPQRFPRESLEET
FT                   VGPRRGEVGLNALVTEEGDAIVSFSVDSECSDLVA"
     MGIFEDHDSS LRLGTFGSFA EVIGGVNTRP NSLSECDLQG VDGGLRRPAA PAAVLLEVMI        60
     PLAALRSSLF DIWVQVRGDA RQQARAGRNY TALLVRSTDS YHMRGHCSSG NCRTTAGRLL       120
     PQSESGLIRH LRRGYRYARR VACQGQGSNR TPQRFPRESL EETVGPRRGE VGLNALVTEE       180
     GDAIVSFSVD SECSDLVA                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page