(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE374

PENCW_13.PE374       Location/Qualifiers
FT   CDS             join(845730..845738,846076..846390)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947711"
FT                   /orf_name="Pc16g03740"
FT                   /product="Pc16g03740 protein"
FT                   /protein_id="CAP93044.1"
FT                   /db_xref="UniParc:UPI000183124F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7T8"
FT                   /transl_table=1
FT                   /translation="MQMSAISTGINNAGSLLGYHYIPGGAEECDGCPAYNNQICKSAAA
FT                   GAAPIQSPWGPIISSRRTLYLSHIVRIDSTEKATGTIRYRSSYLANRSPTALIEAKSQK
FT                   EGY"
     MQMSAISTGI NNAGSLLGYH YIPGGAEECD GCPAYNNQIC KSAAAGAAPI QSPWGPIISS        60
     RRTLYLSHIV RIDSTEKATG TIRYRSSYLA NRSPTALIEA KSQKEGY                     107
//

If you have problems or comments...

PBIL Back to PBIL home page