(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE375

PENCW_13.PE375       Location/Qualifiers
FT   CDS             join(complement(847752..848317),complement(846616..847687))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000237402" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947712"
FT                   /orf_name="Pc16g03750"
FT                   /product="Pc16g03750 protein"
FT                   /protein_id="CAP93045.1"
FT                   /db_xref="InterPro:IPR010354"
FT                   /db_xref="UniParc:UPI0001831250"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7T9"
FT                   /transl_table=1
FT                   /translation="MEKTKKARIRGKRDPKQTEAWILGTGTASLASAFYLIKHAKAPPR
FT                   KVHILESCDSLQEIWHHKGDPTSGYDQFAGCLPVPIGEPLKELLSCIPSAFPTTSRRAS
FT                   FLHAIQSAEVNRTFATQVNNTCIVVQKDGKLQNIVTSSLDLNFKQRLNLVRFMLKGEGR
FT                   LGRNHISDFFPQNFFETSFWAIWSAQFGLQPWHSATEFRRALRHYLGDFHNLSILNCLD
FT                   ITGYYQFESIFLPICLFLESLDVDFQFDTKVRAIVTTSNNDTRTISRLELSQNGFLTHK
FT                   DLGPHDIVIATLGSTESGAAVGSNDHQPVMLSFDACDQFDENWSLWLTLAPIGRDFGNP
FT                   YAFCTRRPQSMVESFTITTKEVNFFNYLTSLSQSTLATGALIVLRESRWKLNLCIPAQP
FT                   VFQYQPEDVRVLWGFAIFPEGIGDYVKKPMLQCSGAEIMTELLKHLNYPSELVFRHTVN
FT                   IPRVMPRMSAIILAHSRDERPEVVPRNTSNIGLVGQFVEIPQYSCIDMSYAARSAQMVV
FT                   SRLMGIDIPSAEVKRSLTALLIRILLWK"
     MEKTKKARIR GKRDPKQTEA WILGTGTASL ASAFYLIKHA KAPPRKVHIL ESCDSLQEIW        60
     HHKGDPTSGY DQFAGCLPVP IGEPLKELLS CIPSAFPTTS RRASFLHAIQ SAEVNRTFAT       120
     QVNNTCIVVQ KDGKLQNIVT SSLDLNFKQR LNLVRFMLKG EGRLGRNHIS DFFPQNFFET       180
     SFWAIWSAQF GLQPWHSATE FRRALRHYLG DFHNLSILNC LDITGYYQFE SIFLPICLFL       240
     ESLDVDFQFD TKVRAIVTTS NNDTRTISRL ELSQNGFLTH KDLGPHDIVI ATLGSTESGA       300
     AVGSNDHQPV MLSFDACDQF DENWSLWLTL APIGRDFGNP YAFCTRRPQS MVESFTITTK       360
     EVNFFNYLTS LSQSTLATGA LIVLRESRWK LNLCIPAQPV FQYQPEDVRV LWGFAIFPEG       420
     IGDYVKKPML QCSGAEIMTE LLKHLNYPSE LVFRHTVNIP RVMPRMSAII LAHSRDERPE       480
     VVPRNTSNIG LVGQFVEIPQ YSCIDMSYAA RSAQMVVSRL MGIDIPSAEV KRSLTALLIR       540
     ILLWK                                                                   545
//

If you have problems or comments...

PBIL Back to PBIL home page