(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE377

PENCW_13.PE377       Location/Qualifiers
FT   CDS             851671..852510
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000219622" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824344"
FT                   /orf_name="Pc16g03770"
FT                   /product="Pc16g03770 protein"
FT                   /protein_id="CAP93047.1"
FT                   /db_xref="InterPro:IPR008579"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017627"
FT                   /db_xref="UniParc:UPI0001831251"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7U0"
FT                   /transl_table=1
FT                   /translation="MGNDQKLGAYYAPKGGLPPQTQILTDRAMFTEAYAVIPKGTFSDI
FT                   VTSFLPFWDKTRLWVIARPLSGFAETFSQYIMEVQPGGGSDRGETDDSAQGVVFVVEGE
FT                   VTITLGSQKHTLAEGGYAYLPPKSGWTLRNTGATTARFHWIRKAYEYVEGLDKPEPLFL
FT                   NEKDIPPTPMPNTNGAWATTRFVDPSDLRHDMHVTIVTFEPGGLIPFAETHVMEHGLYV
FT                   LEGKAVYRLNQDWVEVEAGDFMWLRAFCPQACYAGGPGKFRYLLYKDVNRQMKLSRL"
     MGNDQKLGAY YAPKGGLPPQ TQILTDRAMF TEAYAVIPKG TFSDIVTSFL PFWDKTRLWV        60
     IARPLSGFAE TFSQYIMEVQ PGGGSDRGET DDSAQGVVFV VEGEVTITLG SQKHTLAEGG       120
     YAYLPPKSGW TLRNTGATTA RFHWIRKAYE YVEGLDKPEP LFLNEKDIPP TPMPNTNGAW       180
     ATTRFVDPSD LRHDMHVTIV TFEPGGLIPF AETHVMEHGL YVLEGKAVYR LNQDWVEVEA       240
     GDFMWLRAFC PQACYAGGPG KFRYLLYKDV NRQMKLSRL                              279
//

If you have problems or comments...

PBIL Back to PBIL home page