(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE378

PENCW_13.PE378       Location/Qualifiers
FT   CDS             join(complement(854037..854145),complement(853030..853970))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000294684" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947713"
FT                   /orf_name="Pc16g03780"
FT                   /product="Pc16g03780 protein"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP93048.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001831252"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7Y7"
FT                   /transl_table=1
FT                   /translation="MATQSAIVVQGPGRATLEDVPLPEVPDDYILVKTKAVALNPTDWR
FT                   HIDFVPCTGATVGCDYSGIVEAVGPRVKKAFKKGDRVAGFVHGSNAVRNNGGAFAQYVI
FT                   AKGDLQILIPESMSFEAAATFGVGLTTVGQNLYQSMELPFPGNQDSESDDTNILIYGGA
FT                   TATGTLAIQLAKLSGLRVVTTCSEANRSFMFELGADAVFDYHDPLVGEQIREDTDDALE
FT                   FVLDTISTPQSAAICSAAISSAGGSYNALLDVASARDDVDSHVSMAYDVLGEPYRMGTN
FT                   ERAPDSTNFEFGVKWWGLAQKLIEERRIHPHPYQVKPGGLAGALAGLQILREGKVRASK
FT                   LVYRVDESE"
     MATQSAIVVQ GPGRATLEDV PLPEVPDDYI LVKTKAVALN PTDWRHIDFV PCTGATVGCD        60
     YSGIVEAVGP RVKKAFKKGD RVAGFVHGSN AVRNNGGAFA QYVIAKGDLQ ILIPESMSFE       120
     AAATFGVGLT TVGQNLYQSM ELPFPGNQDS ESDDTNILIY GGATATGTLA IQLAKLSGLR       180
     VVTTCSEANR SFMFELGADA VFDYHDPLVG EQIREDTDDA LEFVLDTIST PQSAAICSAA       240
     ISSAGGSYNA LLDVASARDD VDSHVSMAYD VLGEPYRMGT NERAPDSTNF EFGVKWWGLA       300
     QKLIEERRIH PHPYQVKPGG LAGALAGLQI LREGKVRASK LVYRVDESE                   349
//

If you have problems or comments...

PBIL Back to PBIL home page