(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE38

PENCW_13.PE38        Location/Qualifiers
FT   CDS             join(85399..85516,85672..86411)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234825" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128157"
FT                   /orf_name="Pc16g00380"
FT                   /product="Pc16g00380 protein"
FT                   /function="prenyltransferase activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP92708.1"
FT                   /db_xref="GO:0004659"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="UniParc:UPI0001831E97"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6U1"
FT                   /transl_table=1
FT                   /translation="MTVSITPKPQRNVARGVWELARLHTREAWLCWYPAIWGALCISDI
FT                   CDQKLDKHVERCKVRPLPSGMISTSEAVVAFICWLPVTLAITWGTLGPAVTAGFIPVWV
FT                   LSTIYPFMKRIMPFPQVVLGAIIGGAVFPGWVGITGDLKDLDQALPLFFATASWVVYFD
FT                   VFYATQDRPDDEKIGVKSLAVLLGKNVQILLAVLGALQVLLFAVTALRADMSLIFWVLG
FT                   LGVWMVNVPWHILSLDLKDRHSGGRIFKSNIKLGLYLTGVSLLELFVVRVYDISLANMK
FT                   MELH"
     MTVSITPKPQ RNVARGVWEL ARLHTREAWL CWYPAIWGAL CISDICDQKL DKHVERCKVR        60
     PLPSGMISTS EAVVAFICWL PVTLAITWGT LGPAVTAGFI PVWVLSTIYP FMKRIMPFPQ       120
     VVLGAIIGGA VFPGWVGITG DLKDLDQALP LFFATASWVV YFDVFYATQD RPDDEKIGVK       180
     SLAVLLGKNV QILLAVLGAL QVLLFAVTAL RADMSLIFWV LGLGVWMVNV PWHILSLDLK       240
     DRHSGGRIFK SNIKLGLYLT GVSLLELFVV RVYDISLANM KMELH                       285
//

If you have problems or comments...

PBIL Back to PBIL home page