(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE380

PENCW_13.PE380       Location/Qualifiers
FT   CDS             join(855495..855698,855758..855902,855964..856232,
FT                   856290..856652,856717..857644,857721..862063,
FT                   862121..862790,862853..863004)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160879" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671665"
FT                   /orf_name="Pc16g03800"
FT                   /product="Pc16g03800 protein"
FT                   /function="acyl carrier activity"
FT                   /function="cofactor binding"
FT                   /function="transferase activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="CAP93050.1"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR020842"
FT                   /db_xref="UniParc:UPI0001831254"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7Y9"
FT                   /transl_table=1
FT                   /translation="MPGRPTSAPTEMEGIAVIGMGCRFSGGATSVENFWQMLCDGRTGH
FT                   GTVPTSRYEASAWHHPSHERKGAINHDSGFFLQEDPSRFDAPFFSITAKEAAGMDPAQR
FT                   LLLEVAYETFENSGIPIDTLPGSNTAVYSGSMTNDYELLSTRDIYDMPHNSATGNGRTM
FT                   LANRLSWFFDLQGPSIMMDTACSSSLTAVHLAAQSLRSGECGMALVTGASLILHPNFTQ
FT                   RLSYMHMMSADGISHSFDESANGYGRGEGIGAVLLKPLSAALADGDNIRAVIRGTGINQ
FT                   DGRTPGITLPSPTSQANLIRSVYERHGISMRDTSYFEAHGTGTPVGDPTELSAVGATLG
FT                   QARTPTDEPIYVGSVKTNFGHTEGAAGVASLIKVVLCLEKGMLVPNAGFKNINPKIRLD
FT                   DWRLRLSDKTMPWPDHLPQRASINSFGFGGSNAHLILESTKEALGGNAEDKEPAPHVVV
FT                   FSTFDQAGIERASQNWSTFLQRQQKTEQEIPLKDLAHTMLTRRSQLGFRSFAVANSQDQ
FT                   LQTILDKGLPKFPRASRKAQTRLAFVFTGQGGQWAGMGRELLRISTFRESIARSQDILS
FT                   SLGCPFDMVEEIKAEAKDSQINRPDRSQPITCALQIALVDLLASWSVYPNAVVGHSSGE
FT                   IAAGYAAGYLSREDAMRVAWFRGFFSQQIAQSDRRGGMLATGISAADAQKYLQELPPRS
FT                   VVVACVNSPASTTLSGDVDLIDKLEARLQQDGHFARKLRIDTAYHSPHMEDLVEVVGNA
FT                   INCIKPEDRYSGSIPMLSSVTKERVYPAELGGSYWVRNMISSVEFTAAVSQLANLSESI
FT                   KSRRRPVPIKWTALVEIGPHAVLKGPVTQILQSVNPSMASLPYYSLVSRNQHALRTALE
FT                   VAGSLWSTGHTVDLAAVNSSVDTTSPKMVADLPSYPWNHQTSFWHEPVETAQLRQRKHP
FT                   RHDILGAAVDYQNALEPRWRNFLRLSENPWMADHVVAGSIVFPAAGMLVMATEAARQLA
FT                   DDQANIKGIEFQDLRFMRGVVIPDEERGLETLLQVSPHPGMPGWYQFGIFSLPSGGAWI
FT                   QHAKGAFIARYENRDNDEHNANWEAALERIKNTQTVAKMADVRQSREWLSHTGGLTVGP
FT                   AFQTITGVSFCDAEPRLWLSGVVTDTKQSMPFEKESPSFIHPTTLDCLFQSALLSCSDA
FT                   LSNNNANIPVGVDNIYISNAFQPQAGEQFVVHTETKWRDGKSRSHCIASDPSWSQPWIT
FT                   FEGVHLGRLPFNPNSQKKVEATSESRYSSIVWDEHLESPLVTNQIHDGNKKMAVQASRL
FT                   QLTDWIKRLCHTNGDAKALITTSETSNSWIENLQELISSAGKRPCLGKVTIASCGPNDQ
FT                   VNGITPAENSLPGTQLMPLATLDELPSSSLAQEKYDLVVIDEPRLWEDKLTQVILSCLP
FT                   NILEHGGLAAMRVSDTDLDSAAEKLQRFDGLEIHSTTQNRKFIIARRTPVSWTTDSEIY
FT                   VLSPADNSNSFPVFEHLEKIFATHNVRLVPVGLGQVATLAGKTVISLLDLAAPWVAGWT
FT                   ENDLERLRELIRVQYVLWVSPCWSQGAVDNIGSGATGGLLRTLRNEQWNTTIPHLLVDV
FT                   EDMEDKFGLACGILQVMQLTTQESARRPDLEYRLANGRLLVPRVLETPAVDEAMHTLIN
FT                   GPRPVLSDLTLDPRPLELKFQDADNARWEEQQLSEEQLRPDHSEIKVEMATIFDLHGEQ
FT                   GKTPETVLPMFEIVGTVTRIGSDVHDSAVGDKVLTLASANSGLSTTMRVSESDTIRIPA
FT                   NTDATKAISTPLAYLNAYQILTQVGRLSSSSSVLLVGSVNQTLQAMIDYALAMNMQVIV
FT                   ATDSLDSTESLRSRYPVLADRILGVQGSLETSVSRLTNGCGVDATICFLGGYAGRNAAR
FT                   CLVQGGQYINLSSEMKLSALPESFVDSGCTFSSPRLQKAFSEKPGNLHASLRHVIDFMK
FT                   QHRMLDRVESYSLFPISDLQGALKHCKATNTRAIMDLQAPGRVPIVLPLPDLTGLPAGG
FT                   TYILAGGLGNLGLALADTLVQSGARHLVFLGRSGGTQPSQQLALDQLRDRGCCIDVLRC
FT                   DISQQGDIDHLSYKIRSKNWTVAGVIQCTTVLRDAMFEKMTFDDWTQSTQSKIRGTLNL
FT                   HHLFSEKEGLTFFVALSSVASVIGNMGQANYSAGNGFIDALMEWRRSHGLPGHSINIGL
FT                   VPDASGLSDIAEDQEQRRRRYKHLEGTEIMTHELQTLLRVIINSKLSLPSQIIAGMTDS
FT                   LSRSNGSTPWVLDRKFDHRLCLAVEDTQDSIQTSTLLKECDSIDAATEIVLNTLSEYLA
FT                   DAMATTADAIDSDLPLSALGVDSLKATAVQNWVSRELGAELSSFEFLGSQPTKALARKI
FT                   ASTSSFVSVPS"
     MPGRPTSAPT EMEGIAVIGM GCRFSGGATS VENFWQMLCD GRTGHGTVPT SRYEASAWHH        60
     PSHERKGAIN HDSGFFLQED PSRFDAPFFS ITAKEAAGMD PAQRLLLEVA YETFENSGIP       120
     IDTLPGSNTA VYSGSMTNDY ELLSTRDIYD MPHNSATGNG RTMLANRLSW FFDLQGPSIM       180
     MDTACSSSLT AVHLAAQSLR SGECGMALVT GASLILHPNF TQRLSYMHMM SADGISHSFD       240
     ESANGYGRGE GIGAVLLKPL SAALADGDNI RAVIRGTGIN QDGRTPGITL PSPTSQANLI       300
     RSVYERHGIS MRDTSYFEAH GTGTPVGDPT ELSAVGATLG QARTPTDEPI YVGSVKTNFG       360
     HTEGAAGVAS LIKVVLCLEK GMLVPNAGFK NINPKIRLDD WRLRLSDKTM PWPDHLPQRA       420
     SINSFGFGGS NAHLILESTK EALGGNAEDK EPAPHVVVFS TFDQAGIERA SQNWSTFLQR       480
     QQKTEQEIPL KDLAHTMLTR RSQLGFRSFA VANSQDQLQT ILDKGLPKFP RASRKAQTRL       540
     AFVFTGQGGQ WAGMGRELLR ISTFRESIAR SQDILSSLGC PFDMVEEIKA EAKDSQINRP       600
     DRSQPITCAL QIALVDLLAS WSVYPNAVVG HSSGEIAAGY AAGYLSREDA MRVAWFRGFF       660
     SQQIAQSDRR GGMLATGISA ADAQKYLQEL PPRSVVVACV NSPASTTLSG DVDLIDKLEA       720
     RLQQDGHFAR KLRIDTAYHS PHMEDLVEVV GNAINCIKPE DRYSGSIPML SSVTKERVYP       780
     AELGGSYWVR NMISSVEFTA AVSQLANLSE SIKSRRRPVP IKWTALVEIG PHAVLKGPVT       840
     QILQSVNPSM ASLPYYSLVS RNQHALRTAL EVAGSLWSTG HTVDLAAVNS SVDTTSPKMV       900
     ADLPSYPWNH QTSFWHEPVE TAQLRQRKHP RHDILGAAVD YQNALEPRWR NFLRLSENPW       960
     MADHVVAGSI VFPAAGMLVM ATEAARQLAD DQANIKGIEF QDLRFMRGVV IPDEERGLET      1020
     LLQVSPHPGM PGWYQFGIFS LPSGGAWIQH AKGAFIARYE NRDNDEHNAN WEAALERIKN      1080
     TQTVAKMADV RQSREWLSHT GGLTVGPAFQ TITGVSFCDA EPRLWLSGVV TDTKQSMPFE      1140
     KESPSFIHPT TLDCLFQSAL LSCSDALSNN NANIPVGVDN IYISNAFQPQ AGEQFVVHTE      1200
     TKWRDGKSRS HCIASDPSWS QPWITFEGVH LGRLPFNPNS QKKVEATSES RYSSIVWDEH      1260
     LESPLVTNQI HDGNKKMAVQ ASRLQLTDWI KRLCHTNGDA KALITTSETS NSWIENLQEL      1320
     ISSAGKRPCL GKVTIASCGP NDQVNGITPA ENSLPGTQLM PLATLDELPS SSLAQEKYDL      1380
     VVIDEPRLWE DKLTQVILSC LPNILEHGGL AAMRVSDTDL DSAAEKLQRF DGLEIHSTTQ      1440
     NRKFIIARRT PVSWTTDSEI YVLSPADNSN SFPVFEHLEK IFATHNVRLV PVGLGQVATL      1500
     AGKTVISLLD LAAPWVAGWT ENDLERLREL IRVQYVLWVS PCWSQGAVDN IGSGATGGLL      1560
     RTLRNEQWNT TIPHLLVDVE DMEDKFGLAC GILQVMQLTT QESARRPDLE YRLANGRLLV      1620
     PRVLETPAVD EAMHTLINGP RPVLSDLTLD PRPLELKFQD ADNARWEEQQ LSEEQLRPDH      1680
     SEIKVEMATI FDLHGEQGKT PETVLPMFEI VGTVTRIGSD VHDSAVGDKV LTLASANSGL      1740
     STTMRVSESD TIRIPANTDA TKAISTPLAY LNAYQILTQV GRLSSSSSVL LVGSVNQTLQ      1800
     AMIDYALAMN MQVIVATDSL DSTESLRSRY PVLADRILGV QGSLETSVSR LTNGCGVDAT      1860
     ICFLGGYAGR NAARCLVQGG QYINLSSEMK LSALPESFVD SGCTFSSPRL QKAFSEKPGN      1920
     LHASLRHVID FMKQHRMLDR VESYSLFPIS DLQGALKHCK ATNTRAIMDL QAPGRVPIVL      1980
     PLPDLTGLPA GGTYILAGGL GNLGLALADT LVQSGARHLV FLGRSGGTQP SQQLALDQLR      2040
     DRGCCIDVLR CDISQQGDID HLSYKIRSKN WTVAGVIQCT TVLRDAMFEK MTFDDWTQST      2100
     QSKIRGTLNL HHLFSEKEGL TFFVALSSVA SVIGNMGQAN YSAGNGFIDA LMEWRRSHGL      2160
     PGHSINIGLV PDASGLSDIA EDQEQRRRRY KHLEGTEIMT HELQTLLRVI INSKLSLPSQ      2220
     IIAGMTDSLS RSNGSTPWVL DRKFDHRLCL AVEDTQDSIQ TSTLLKECDS IDAATEIVLN      2280
     TLSEYLADAM ATTADAIDSD LPLSALGVDS LKATAVQNWV SRELGAELSS FEFLGSQPTK      2340
     ALARKIASTS SFVSVPS                                                     2357
//

If you have problems or comments...

PBIL Back to PBIL home page