(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE381

PENCW_13.PE381       Location/Qualifiers
FT   CDS             864367..866034
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000176579" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128689"
FT                   /orf_name="Pc16g03810"
FT                   /product="Pc16g03810 protein"
FT                   /protein_id="CAP93051.1"
FT                   /db_xref="UniParc:UPI0001831320"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7Z0"
FT                   /transl_table=1
FT                   /translation="MADAEKNDLCMPAPPAKAIVVDHDMPTGPDHEQTIVVDHDMAIAP
FT                   DSEQIIVIDDDLAIDPDLEKVTDNNDASKETPIPPNGHDSSDATDLEAQQTEPRRKRFA
FT                   RFRYAMFTVYRRLFTVVFCANLAVFLYVMIADRRLLALVNATAVNLVACGLARHPMMVN
FT                   AIYRAVCSIPRSAPLSLRRRCAKAAHYGGVHSGCGTASLVWYIGFVAMVSQIYWTNSPI
FT                   STVTDASFSAAPIAVAYVILVLLFVMIVVAYPTFRRKMHDLFELTHRFTSWLILALFVA
FT                   LVMIFAHEVGRAEKHSLGHAVVTLPAFWLLIVAILAVAHPWLLLRRVPVKAEPLSKHAV
FT                   RLSFDFTPISFAKGVQVSKHPLRDWHSFAGFPDPIPADAKPVAKNASRKKPFVKGHGHK
FT                   RSWSIVVSKAGDWTADTIREPPTHLWKRGSLMRGVGYGLRMFNRIIIVTTGSGIGPCLG
FT                   FLGDKKRPLIKVIWQTRDPLKTYGQDVLDLVHQMGPDPIIFDTSRDGRVDMLPVVRQQV
FT                   KEFQAEAVFVISNPKMTQNIVYEFESQGIPAYGPIFDS"
     MADAEKNDLC MPAPPAKAIV VDHDMPTGPD HEQTIVVDHD MAIAPDSEQI IVIDDDLAID        60
     PDLEKVTDNN DASKETPIPP NGHDSSDATD LEAQQTEPRR KRFARFRYAM FTVYRRLFTV       120
     VFCANLAVFL YVMIADRRLL ALVNATAVNL VACGLARHPM MVNAIYRAVC SIPRSAPLSL       180
     RRRCAKAAHY GGVHSGCGTA SLVWYIGFVA MVSQIYWTNS PISTVTDASF SAAPIAVAYV       240
     ILVLLFVMIV VAYPTFRRKM HDLFELTHRF TSWLILALFV ALVMIFAHEV GRAEKHSLGH       300
     AVVTLPAFWL LIVAILAVAH PWLLLRRVPV KAEPLSKHAV RLSFDFTPIS FAKGVQVSKH       360
     PLRDWHSFAG FPDPIPADAK PVAKNASRKK PFVKGHGHKR SWSIVVSKAG DWTADTIREP       420
     PTHLWKRGSL MRGVGYGLRM FNRIIIVTTG SGIGPCLGFL GDKKRPLIKV IWQTRDPLKT       480
     YGQDVLDLVH QMGPDPIIFD TSRDGRVDML PVVRQQVKEF QAEAVFVISN PKMTQNIVYE       540
     FESQGIPAYG PIFDS                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page