(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE384

PENCW_13.PE384       Location/Qualifiers
FT   CDS             join(complement(871134..871366),complement(870809..871016))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977575"
FT                   /orf_name="Pc16g03840"
FT                   /product="Putative uncharacterized protein Pc16g03840 "
FT                   /protein_id="CAP93054.1"
FT                   /db_xref="UniParc:UPI0001831323"
FT                   /db_xref="UniProtKB/TrEMBL:B6H7Z3"
FT                   /transl_table=1
FT                   /translation="MEMPQRLGLDESEHLYGRNSFILPDMEIYIEIWPQRLELDESEHL
FT                   YNVNSFILSDIDIYMVCTVEMPQRLGLDESEHFLKSGKIRQNQAKLRHPPYKIRHPTPG
FT                   RYTPSQIPLFVFVNYKVLDLVLGKCSTSVKKWINNASSGLIQ"
     MEMPQRLGLD ESEHLYGRNS FILPDMEIYI EIWPQRLELD ESEHLYNVNS FILSDIDIYM        60
     VCTVEMPQRL GLDESEHFLK SGKIRQNQAK LRHPPYKIRH PTPGRYTPSQ IPLFVFVNYK       120
     VLDLVLGKCS TSVKKWINNA SSGLIQ                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page